• Gene id: 57805

Gene Summary

• Gene Symbol: CCAR2   Gene   UCSC   Ensembl
• Aliases: DBC-1, DBC1, KIAA1967, NET35, p30 DBC, p30DBC
• Gene name: cell cycle and apoptosis regulator 2
• Alternate names: cell cycle and apoptosis regulator protein 2, cell division cycle and apoptosis regulator protein 2, deleted in breast cancer 1, p30 DBC protein,
• Gene location: 8p21.3 (22604739: 22621513)     Exons: 7     NC_000008.11
• OMIM: 607359

Protein Summary

• Protein general information: Q8N163  
  • Name: Cell cycle and apoptosis regulator protein 2 (Cell division cycle and apoptosis regulator protein 2) (DBIRD complex subunit KIAA1967) (Deleted in breast cancer gene 1 protein) (DBC 1) (DBC.1) (NET35) (p30 DBC)
  • Length: 923  
  • Mass: 102902
  • Tissue specificity: Expressed in gastric carcinoma tissue and the expression gradually increases with the progression of the carcinoma (at protein level). Expressed ubiquitously in normal tissues. Expressed in 84 to 100% of neoplastic breast, lung, and co
• Sequence:

  MSQFKRQRINPLPGGRNFSGTASTSLLGPPPGLLTPPVATELSQNARHLQGGEKQRVFTGIVTSLHDYFGVVDEE
  VFFQLSVVKGRLPQLGEKVLVKAAYNPGQAVPWNAVKVQTLSNQPLLKSPAPPLLHVAALGQKQGILGAQPQLIF
  QPHRIPPLFPQKPLSLFQTSHTLHLSHLNRFPARGPHGRLDQGRSDDYDSKKRKQRAGGEPWGAKKPRHDLPPYR
  VHLTPYTVDSPICDFLELQRRYRSLLVPSDFLSVHLSWLSAFPLSQPFSLHHPSRIQVSSEKEAAPDAGAEPITA
  DSDPAYSSKVLLLSSPGLEELYRCCMLFVDDMAEPRETPEHPLKQIKFLLGRKEEEAVLVGGEWSPSLDGLDPQA
  DPQVLVRTAIRCAQAQTGIDLSGCTKWWRFAEFQYLQPGPPRRLQTVVVYLPDVWTIMPTLEEWEALCQQKAAEA
  APPTQEAQGETEPTEQAPDALEQAADTSRRNAETPEATTQQETDTDLPEAPPPPLEPAVIARPGCVNLSLHGIVE
  DRRPKERISFEVMVLAELFLEMLQRDFGYRVYKMLLSLPEKVVSPPEPEKEEAAKEEATKEEEAIKEEVVKEPKD
  EAQNEGPATESEAPLKEDGLLPKPLSSGGEEEEKPRGEASEDLCEMALDPELLLLRDDGEEEFAGAKLEDSEVRS
  VASNQSEMEFSSLQDMPKELDPSAVLPLDCLLAFVFFDANWCGYLHRRDLERILLTLGIRLSAEQAKQLVSRVVT
  QNICQYRSLQYSRQEGLDGGLPEEVLFGNLDLLPPPGKSTKPGAAPTEHKALVSHNGSLINVGSLLQRAEQQDSG
  RLYLENKIHTLELKLEESHNRFSATEVTNKTLAAEMQELRVRLAEAEETARTAERQKSQLQRLLQELRRRLTPLQ
  LEIQRVVEKADSWVEKEEPAPSN

• Structural information:
  • Interpro: IPR025224  IPR028811  IPR025954  IPR011992  IPR025223  
  • DIP: 38122
  • STRING: ENSP00000310670
• Other Databases: GeneCards:  CCAR2  Malacards:  CCAR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000993	RNA polymerase II complex binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IBA	biological process
GO:0008380	RNA splicing	IBA	biological process
GO:0030374	nuclear receptor transcription coactivator activity	IBA	molecular function
GO:0044609	DBIRD complex	IBA	cellular component
GO:0044609	DBIRD complex	IDA	cellular component
GO:0004857	enzyme inhibitor activity	IDA	molecular function
GO:0004857	enzyme inhibitor activity	IDA	molecular function
GO:0032435	negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0000993	RNA polymerase II complex binding	IDA	molecular function
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0031647	regulation of protein stability	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0090311	regulation of protein deacetylation	IDA	biological process
GO:0032784	regulation of DNA-templated transcription, elongation	IMP	biological process
GO:0004857	enzyme inhibitor activity	IMP	molecular function
GO:0030308	negative regulation of cell growth	IMP	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0043086	negative regulation of catalytic activity	IMP	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:2000003	positive regulation of DNA damage checkpoint	IMP	biological process
GO:1902230	negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage	IMP	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0009411	response to UV	IMP	biological process
GO:0008380	RNA splicing	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0042752	regulation of circadian rhythm	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090263	positive regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0044609	DBIRD complex	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0004857	enzyme inhibitor activity	IEA	molecular function
GO:0048511	rhythmic process	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0006397	mRNA processing	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042752	regulation of circadian rhythm	IEA	biological process
GO:0004857	enzyme inhibitor activity	IEA	molecular function
GO:0043086	negative regulation of catalytic activity	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:0005759	mitochondrial matrix	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0043653	mitochondrial fragmentation involved in apoptotic process	IDA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)