• Gene id: 57804

Gene Summary

• Gene Symbol: POLD4   Gene   UCSC   Ensembl
• Aliases: POLDS, p12
• Gene name: DNA polymerase delta 4, accessory subunit
• Alternate names: DNA polymerase delta subunit 4, DNA polymerase delta smallest subunit p12, polymerase (DNA) delta 4, accessory subunit, polymerase (DNA-directed), delta 4, accessory subunit,
• Gene location: 11q13.2 (67353595: 67350764)     Exons: 4     NC_000011.10
• Gene summary(Entrez): This gene encodes the smallest subunit of DNA polymerase delta. DNA polymerase delta possesses both polymerase and 3' to 5' exonuclease activity and plays a critical role in DNA replication and repair. The encoded protein enhances the activity of DNA poly
• OMIM: 605106

Protein Summary

• Protein general information: Q9HCU8  
  • Name: DNA polymerase delta subunit 4 (DNA polymerase delta subunit p12)
  • Length: 107  
  • Mass: 12433
• Sequence:

  MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLRQFDLAWQYGPCTGITRLQRWCRAKQ
  MGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPL

• Structural information:
  • Interpro: IPR007218  
  • PDB: 6HVO 6S1M 6S1N 6S1O 6TNY 6TNZ
  • PDBsum: 6HVO 6S1M 6S1N 6S1O 6TNY 6TNZ
  • STRING: ENSP00000311368
• Other Databases: GeneCards:  POLD4  Malacards:  POLD4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003887	DNA-directed DNA polymerase activity	IBA	contributes to
GO:0006261	DNA-dependent DNA replication	IBA	biological process
GO:0000731	DNA synthesis involved in DNA repair	IBA	biological process
GO:0043625	delta DNA polymerase complex	IBA	cellular component
GO:0006260	DNA replication	IEA	biological process
GO:0042025	host cell nucleus	IEA	cellular component
GO:0006260	DNA replication	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0006283	transcription-coupled nucleotide-excision repair	TAS	biological process
GO:0033683	nucleotide-excision repair, DNA incision	TAS	biological process
GO:0000723	telomere maintenance	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006296	nucleotide-excision repair, DNA incision, 5'-to lesion	TAS	biological process
GO:0006297	nucleotide-excision repair, DNA gap filling	TAS	biological process
GO:0006298	mismatch repair	TAS	biological process
GO:0006298	mismatch repair	TAS	biological process
GO:0019985	translesion synthesis	TAS	biological process
GO:0032201	telomere maintenance via semi-conservative replication	TAS	biological process
GO:0032201	telomere maintenance via semi-conservative replication	TAS	biological process
GO:0032201	telomere maintenance via semi-conservative replication	TAS	biological process
GO:0032201	telomere maintenance via semi-conservative replication	TAS	biological process
GO:0032201	telomere maintenance via semi-conservative replication	TAS	biological process
GO:0032201	telomere maintenance via semi-conservative replication	TAS	biological process
GO:0042769	DNA damage response, detection of DNA damage	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03420	Nucleotide excision repair
hsa03440	Homologous recombination
hsa03030	DNA replication
hsa03410	Base excision repair
hsa03430	Mismatch repair

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray