• Gene id: 578

Gene Summary

• Gene Symbol: BAK1   Gene   UCSC   Ensembl
• Aliases: BAK, BAK-LIKE, BCL2L7, CDN1
• Gene name: BCL2 antagonist/killer 1
• Alternate names: bcl-2 homologous antagonist/killer, BCL2-like 7 protein, apoptosis regulator BAK, bcl-2-like protein 7, bcl2-L-7, pro-apoptotic protein BAK,
• Gene location: 6p21.31 (33580295: 33572545)     Exons: 7     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mito
• OMIM: 600516

SNPs

rs1368677

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000009.12   g.8972798T>A
NC_000009.11   g.8972798T>A
NG_033963.1   g.1644926A>T|SEQ=[T/A]|GENE=PTPRD

Protein Summary

• Protein general information: Q16611  
  • Name: Bcl 2 homologous antagonist/killer (Apoptosis regulator BAK) (Bcl 2 like protein 7) (Bcl2 L 7)
  • Length: 211  
  • Mass: 23,409
• Sequence:

  MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVG
  RQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGF
  LGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS

• Structural information:
  • Interpro: IPR026308  IPR002475  IPR020717  IPR020726  IPR020728   IPR036834  IPR026298  
  • Prosite: PS50062 PS01080 PS01258 PS01259
  • PDB: 1BXL 2IMS 2IMT 2JBY 2JCN 2LP8 2M5B 2XPX 2YV6 3I1H 3QBR 4D2L 4U2U 4U2V 4UF1 5AJK 5FMI 5FMK 5VWV 5VWW 5VWX 5VWY 5VWZ 5VX0 5VX1
  • PDBsum: 1BXL 2IMS 2IMT 2JBY 2JCN 2LP8 2M5B 2XPX 2YV6 3I1H 3QBR 4D2L 4U2U 4U2V 4UF1 5AJK 5FMI 5FMK 5VWV 5VWW 5VWX 5VWY 5VWZ 5VX0 5VX1
  • DIP: 935
  • STRING: ENSP00000353878
• Other Databases: GeneCards:  BAK1  Malacards:  BAK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001782	B cell homeostasis	IEA	biological process
GO:0001783	B cell apoptotic process	IEA	biological process
GO:0001836	release of cytochrome c from mitochondria	IDA	biological process
GO:0001836	release of cytochrome c from mitochondria	IGI	biological process
GO:0001836	release of cytochrome c from mitochondria	IDA	biological process
GO:0001974	blood vessel remodeling	IEA	biological process
GO:0002262	myeloid cell homeostasis	IEA	biological process
GO:0002352	B cell negative selection	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IBA	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0006987	activation of signaling protein activity involved in unfolded protein response	TAS	biological process
GO:0007420	brain development	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0008053	mitochondrial fusion	IEA	biological process
GO:0008283	cell proliferation	IEA	biological process
GO:0008285	negative regulation of cell proliferation	IEA	biological process
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IBA	biological process
GO:0008635	activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c	IEA	biological process
GO:0009620	response to fungus	IEA	biological process
GO:0010046	response to mycotoxin	IEA	biological process
GO:0010225	response to UV-C	IEA	biological process
GO:0010248	establishment or maintenance of transmembrane electrochemical gradient	IDA	biological process
GO:0010332	response to gamma radiation	IEA	biological process
GO:0010524	positive regulation of calcium ion transport into cytosol	IEA	biological process
GO:0010629	negative regulation of gene expression	IEA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0019835	cytolysis	IMP	biological process
GO:0031018	endocrine pancreas development	IEA	biological process
GO:0031072	heat shock protein binding	IEA	molecular function
GO:0031100	animal organ regeneration	IEA	biological process
GO:0031307	integral component of mitochondrial outer membrane	ISS	cellular component
GO:0032469	endoplasmic reticulum calcium ion homeostasis	TAS	biological process
GO:0032471	negative regulation of endoplasmic reticulum calcium ion concentration	IEA	biological process
GO:0033137	negative regulation of peptidyl-serine phosphorylation	IEA	biological process
GO:0034644	cellular response to UV	ISS	biological process
GO:0034644	cellular response to UV	IMP	biological process
GO:0035108	limb morphogenesis	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042542	response to hydrogen peroxide	IEA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IBA	molecular function
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0043496	regulation of protein homodimerization activity	IDA	biological process
GO:0043497	regulation of protein heterodimerization activity	IDA	biological process
GO:0044325	ion channel binding	IPI	molecular function
GO:0044346	fibroblast apoptotic process	IEA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0045862	positive regulation of proteolysis	IDA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0046902	regulation of mitochondrial membrane permeability	IDA	biological process
GO:0046902	regulation of mitochondrial membrane permeability	IDA	biological process
GO:0046930	pore complex	IDA	cellular component
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0048597	post-embryonic camera-type eye morphogenesis	IEA	biological process
GO:0051087	chaperone binding	IEA	molecular function
GO:0051400	BH domain binding	IEA	molecular function
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0051881	regulation of mitochondrial membrane potential	IDA	biological process
GO:0060068	vagina development	IEA	biological process
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	TAS	biological process
GO:0070242	thymocyte apoptotic process	IEA	biological process
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0090200	positive regulation of release of cytochrome c from mitochondria	IEA	biological process
GO:0097190	apoptotic signaling pathway	IMP	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	IBA	biological process
GO:0097202	activation of cysteine-type endopeptidase activity	IDA	biological process
GO:1900103	positive regulation of endoplasmic reticulum unfolded protein response	IMP	biological process
GO:1901030	positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	TAS	biological process
GO:1902262	apoptotic process involved in blood vessel morphogenesis	IEA	biological process
GO:1903896	positive regulation of IRE1-mediated unfolded protein response	TAS	biological process
GO:0001776	leukocyte homeostasis	IEA	biological process
GO:0001782	B cell homeostasis	IEA	biological process
GO:0001783	B cell apoptotic process	IEA	biological process
GO:0001836	release of cytochrome c from mitochondria	IEA	biological process
GO:0001836	release of cytochrome c from mitochondria	IDA	biological process
GO:0001836	release of cytochrome c from mitochondria	IGI	biological process
GO:0001836	release of cytochrome c from mitochondria	IDA	biological process
GO:0001974	blood vessel remodeling	IEA	biological process
GO:0002262	myeloid cell homeostasis	IEA	biological process
GO:0002352	B cell negative selection	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005622	intracellular	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IBA	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IEA	biological process
GO:0006987	activation of signaling protein activity involved in unfolded protein response	TAS	biological process
GO:0007420	brain development	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0008053	mitochondrial fusion	IEA	biological process
GO:0008283	cell proliferation	IEA	biological process
GO:0008285	negative regulation of cell proliferation	IEA	biological process
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IEA	biological process
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IBA	biological process
GO:0008635	activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c	IEA	biological process
GO:0009620	response to fungus	IEA	biological process
GO:0010046	response to mycotoxin	IEA	biological process
GO:0010225	response to UV-C	IEA	biological process
GO:0010248	establishment or maintenance of transmembrane electrochemical gradient	IDA	biological process
GO:0010332	response to gamma radiation	IEA	biological process
GO:0010524	positive regulation of calcium ion transport into cytosol	IEA	biological process
GO:0010629	negative regulation of gene expression	IEA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019835	cytolysis	IMP	biological process
GO:0031018	endocrine pancreas development	IEA	biological process
GO:0031072	heat shock protein binding	IEA	molecular function
GO:0031100	animal organ regeneration	IEA	biological process
GO:0031307	integral component of mitochondrial outer membrane	IEA	cellular component
GO:0031307	integral component of mitochondrial outer membrane	ISS	cellular component
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0032469	endoplasmic reticulum calcium ion homeostasis	TAS	biological process
GO:0032471	negative regulation of endoplasmic reticulum calcium ion concentration	IEA	biological process
GO:0033137	negative regulation of peptidyl-serine phosphorylation	IEA	biological process
GO:0034644	cellular response to UV	IEA	biological process
GO:0034644	cellular response to UV	ISS	biological process
GO:0034644	cellular response to UV	IMP	biological process
GO:0035108	limb morphogenesis	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042542	response to hydrogen peroxide	IEA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0042803	protein homodimerization activity	IBA	molecular function
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0043496	regulation of protein homodimerization activity	IDA	biological process
GO:0043497	regulation of protein heterodimerization activity	IDA	biological process
GO:0044325	ion channel binding	IPI	molecular function
GO:0044346	fibroblast apoptotic process	IEA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0045862	positive regulation of proteolysis	IDA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0046902	regulation of mitochondrial membrane permeability	IDA	biological process
GO:0046902	regulation of mitochondrial membrane permeability	IDA	biological process
GO:0046930	pore complex	IDA	cellular component
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0048597	post-embryonic camera-type eye morphogenesis	IEA	biological process
GO:0048872	homeostasis of number of cells	IEA	biological process
GO:0051087	chaperone binding	IEA	molecular function
GO:0051400	BH domain binding	IEA	molecular function
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0051881	regulation of mitochondrial membrane potential	IDA	biological process
GO:0060068	vagina development	IEA	biological process
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IEA	biological process
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	TAS	biological process
GO:0070242	thymocyte apoptotic process	IEA	biological process
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0090200	positive regulation of release of cytochrome c from mitochondria	IEA	biological process
GO:0097190	apoptotic signaling pathway	IMP	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	IBA	biological process
GO:0097202	activation of cysteine-type endopeptidase activity	IDA	biological process
GO:1900103	positive regulation of endoplasmic reticulum unfolded protein response	IMP	biological process
GO:1901030	positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	TAS	biological process
GO:1902262	apoptotic process involved in blood vessel morphogenesis	IEA	biological process
GO:1903896	positive regulation of IRE1-mediated unfolded protein response	TAS	biological process
GO:0001836	release of cytochrome c from mitochondria	IDA	biological process
GO:0001836	release of cytochrome c from mitochondria	IGI	biological process
GO:0001836	release of cytochrome c from mitochondria	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IBA	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0006987	activation of signaling protein activity involved in unfolded protein response	TAS	biological process
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IBA	biological process
GO:0010248	establishment or maintenance of transmembrane electrochemical gradient	IDA	biological process
GO:0019835	cytolysis	IMP	biological process
GO:0031307	integral component of mitochondrial outer membrane	ISS	cellular component
GO:0032469	endoplasmic reticulum calcium ion homeostasis	TAS	biological process
GO:0034644	cellular response to UV	ISS	biological process
GO:0034644	cellular response to UV	IMP	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IBA	molecular function
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0043496	regulation of protein homodimerization activity	IDA	biological process
GO:0043497	regulation of protein heterodimerization activity	IDA	biological process
GO:0044325	ion channel binding	IPI	molecular function
GO:0045862	positive regulation of proteolysis	IDA	biological process
GO:0046902	regulation of mitochondrial membrane permeability	IDA	biological process
GO:0046902	regulation of mitochondrial membrane permeability	IDA	biological process
GO:0046930	pore complex	IDA	cellular component
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0051881	regulation of mitochondrial membrane potential	IDA	biological process
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	TAS	biological process
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0097190	apoptotic signaling pathway	IMP	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	IBA	biological process
GO:0097202	activation of cysteine-type endopeptidase activity	IDA	biological process
GO:1900103	positive regulation of endoplasmic reticulum unfolded protein response	IMP	biological process
GO:1901030	positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	TAS	biological process
GO:1903896	positive regulation of IRE1-mediated unfolded protein response	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04210	Apoptosis
hsa04215	Apoptosis - multiple species
hsa05200	Pathways in cancer
hsa05202	Transcriptional misregulation in cancer
hsa05206	MicroRNAs in cancer
hsa05203	Viral carcinogenesis
hsa05210	Colorectal cancer
hsa05212	Pancreatic cancer
hsa05225	Hepatocellular carcinoma
hsa05226	Gastric cancer
hsa05214	Glioma
hsa05216	Thyroid cancer
hsa05220	Chronic myeloid leukemia
hsa05217	Basal cell carcinoma
hsa05218	Melanoma
hsa05213	Endometrial cancer
hsa05224	Breast cancer
hsa05222	Small cell lung cancer
hsa05223	Non-small cell lung cancer
hsa05130	Pathogenic Escherichia coli infection
hsa05170	Human immunodeficiency virus 1 infection
hsa05162	Measles
hsa05164	Influenza A
hsa05160	Hepatitis C
hsa05168	Herpes simplex virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05169	Epstein-Barr virus infection
hsa05165	Human papillomavirus infection
hsa01524	Platinum drug resistance

Diseases

Associated diseases	References
Cancer	GAD: 16988840
Cancer (testicular)	GAD: 19483681
Cancer (leukemia)	GAD: 19074885
Cancer (lung)	GAD: 18676680
Cancer (bladder)	GAD: 19692168
Cancer (esophageal)	GAD: 20453000
Chronic renal failure	GAD: 21085059
Cancer (lymphoma)	GAD: 18636124
Lymphoproliferative disorders	GAD: 16988840
Varicocele	MIK: 20629644
Male factor infertility	MIK: 26056927
Male factor infertility	MIK: 26056927
Non obstructive azoospermia	MIK: 26056927
Varicocele	MIK: 20629644
Azoospermia	MIK: 26056927
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Azoospermia	MIK: 26056927
Male infertility	MIK: 26056927
Nonobstructive azoospermia, Male infertility	MIK: 26056927
Teratozoospermia	MIK: 17327269
Varicocele	MIK: 20629644

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
26056927	Nonobstructive azoospermia, Male infertility			63 (16 obstructive azoospermia, 11 hypospermatogenesis, 15 maturation arrest, 21 Sertoli cell only)	Male infertility	BAX BAK BCL2 and BCLW
20629644	Varicocele			35 (25 patients with varicocele, 10 normal fertile controls)	Male infertility	PARP Bak and p53
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881