• Gene id: 57795

Gene Summary

• Gene Symbol: BRINP2   Gene   UCSC   Ensembl
• Aliases: DBCCR1L2, FAM5B
• Gene name: BMP/retinoic acid inducible neural specific 2
• Alternate names: BMP/retinoic acid-inducible neural-specific protein 2, DBCCR1-like protein 2, DBCCR1-like2, bone morphogenetic protein/retinoic acid inducible neural-specific 2, bone morphogenic protein/retinoic acid inducible neural-specific 2, family with sequence similarit,
• Gene location: 1q25.2 (45378050: 44809056)     Exons: 22     NC_000006.12

Protein Summary

• Protein general information: Q9C0B6  
  • Name: BMP/retinoic acid inducible neural specific protein 2 (DBCCR1 like protein 2)
  • Length: 783  
  • Mass: 89005
• Sequence:

  MRWQCGTRFRGLRPAVAPWTALLALGLPGWVLAVSATAAAVVPEQHASVAGQHPLDWLLTDRGPFHRAQEYADFM
  ERYRQGFTTRYRIYREFARWKVNNLALERKDFFSLPLPLAPEFIRNIRLLGRRPNLQQVTENLIKKYGTHFLLSA
  TLGGEESLTIFVDKQKLGRKTETTGGASIIGGSGNSTAVSLETLHQLAASYFIDRESTLRRLHHIQIATGAIKVT
  ETRTGPLGCSNYDNLDSVSSVLVQSPENKVQLLGLQVLLPEYLRERFVAAALSYITCSSEGELVCKENDCWCKCS
  PTFPECNCPDADIQAMEDSLLQIQDSWATHNRQFEESEEFQALLKRLPDDRFLNSTAISQFWAMDTSLQHRYQQL
  GAGLKVLFKKTHRILRRLFNLCKRCHRQPRFRLPKERSLSYWWNRIQSLLYCGESTFPGTFLEQSHSCTCPYDQS
  SCQGPIPCALGEGPACAHCAPDNSTRCGSCNPGYVLAQGLCRPEVAESLENFLGLETDLQDLELKYLLQKQDSRI
  EVHSIFISNDMRLGSWFDPSWRKRMLLTLKSNKYKPGLVHVMLALSLQICLTKNSTLEPVMAIYVNPFGGSHSES
  WFMPVNEGSFPDWERTNVDAAAQCQNWTITLGNRWKTFFETVHVYLRSRIKSLDDSSNETIYYEPLEMTDPSKNL
  GYMKINTLQVFGYSLPFDPDAIRDLILQLDYPYTQGSQDSALLQLIELRDRVNQLSPPGKVRLDLFSCLLRHRLK
  LANNEVGRIQSSLRAFNSKLPNPVEYETGKLCS

• Structural information:
  • Protein Domains: (85..28-)
    (/note="MACPF"-)
  • Interpro: IPR033237  IPR020864  
  • STRING: ENSP00000354481
• Other Databases: GeneCards:  BRINP2  Malacards:  BRINP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0030425	dendrite	IBA	cellular component
GO:0045666	positive regulation of neuron differentiation	IBA	biological process
GO:0043025	neuronal cell body	IBA	cellular component
GO:0045930	negative regulation of mitotic cell cycle	IBA	biological process
GO:0071300	cellular response to retinoic acid	IBA	biological process
GO:0045666	positive regulation of neuron differentiation	IEA	biological process
GO:0045930	negative regulation of mitotic cell cycle	IEA	biological process
GO:0007050	cell cycle arrest	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0045666	positive regulation of neuron differentiation	IEA	biological process
GO:0071300	cellular response to retinoic acid	IEA	biological process
GO:0045930	negative regulation of mitotic cell cycle	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
oral squamous cell carcinoma	PMID:21334929
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881