• Gene id: 57787

Gene Summary

• Gene Symbol: MARK4   Gene   UCSC   Ensembl
• Aliases: MARK4L, MARK4S, MARKL1, MARKL1L, PAR-1D
• Gene name: microtubule affinity regulating kinase 4
• Alternate names: MAP/microtubule affinity-regulating kinase 4, MAP/microtubule affinity-regulating kinase like 1, MARK4 serine/threonine protein kinase, epididymis secretory sperm binding protein,
• Gene location: 19q13.32 (45251270: 45305283)     Exons: 18     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the microtubule affinity-regulating kinase family. These protein kinases phosphorylate microtubule-associated proteins and regulate the transition between stable and dynamic microtubules. The encoded protein is associated wit
• OMIM: 209901

Protein Summary

• Protein general information: Q96L34  
  • Name: MAP/microtubule affinity regulating kinase 4 (EC 2.7.11.1) (MAP/microtubule affinity regulating kinase like 1)
  • Length: 752  
  • Mass: 82520
  • Tissue specificity: Ubiquitous. Isoform 2 is brain-specific (PubMed
• Sequence:

  MSSRTVLAPGNDRNSDTHGTLGSGRSSDKGPSWSSRSLGARCRNSIASCPEEQPHVGNYRLLRTIGKGNFAKVKL
  ARHILTGREVAIKIIDKTQLNPSSLQKLFREVRIMKGLNHPNIVKLFEVIETEKTLYLVMEYASAGEVFDYLVSH
  GRMKEKEARAKFRQIVSAVHYCHQKNIVHRDLKAENLLLDAEANIKIADFGFSNEFTLGSKLDTFCGSPPYAAPE
  LFQGKKYDGPEVDIWSLGVILYTLVSGSLPFDGHNLKELRERVLRGKYRVPFYMSTDCESILRRFLVLNPAKRCT
  LEQIMKDKWINIGYEGEELKPYTEPEEDFGDTKRIEVMVGMGYTREEIKESLTSQKYNEVTATYLLLGRKTEEGG
  DRGAPGLALARVRAPSDTTNGTSSSKGTSHSKGQRSSSSTYHRQRRHSDFCGPSPAPLHPKRSPTSTGEAELKEE
  RLPGRKASCSTAGSGSRGLPPSSPMVSSAHNPNKAEIPERRKDSTSTPNNLPPSMMTRRNTYVCTERPGAERPSL
  LPNGKENSSGTPRVPPASPSSHSLAPPSGERSRLARGSTIRSTFHGGQVRDRRAGGGGGGGVQNGPPASPTLAHE
  AAPLPAGRPRPTTNLFTKLTSKLTRRVADEPERIGGPEVTSCHLPWDQTETAPRLLRFPWSVKLTSSRPPEALMA
  ALRQATAAARCRCRQPQPFLLACLHGGAGGPEPLSHFEVEVCQLPRPGLRGVLFRRVAGTALAFRTLVTRISNDL
  EL

• Structural information:
  • Protein Domains: (59..31-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (324..36-)
    (/note="UBA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00212-)
    (703..75-)
    (/note="KA1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00565"-)
  • Interpro: IPR028375  IPR001772  IPR011009  IPR000719  IPR017441   IPR008271  IPR015940  
  • Prosite: PS50032 PS00107 PS50011 PS00108 PS50030
  • PDB: 5ES1
  • PDBsum: 5ES1
  • STRING: ENSP00000262891
• Other Databases: GeneCards:  MARK4  Malacards:  MARK4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005813	centrosome	IDA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0000930	gamma-tubulin complex	IDA	cellular component
GO:0048156	tau protein binding	NAS	molecular function
GO:0050321	tau-protein kinase activity	IMP	molecular function
GO:0004674	protein serine/threonine kinase activity	NAS	molecular function
GO:0050321	tau-protein kinase activity	NAS	molecular function
GO:0045724	positive regulation of cilium assembly	IMP	biological process
GO:0046605	regulation of centrosome cycle	IMP	biological process
GO:0044782	cilium organization	IGI	biological process
GO:0000226	microtubule cytoskeleton organization	IMP	NOT|biological process
GO:1904781	positive regulation of protein localization to centrosome	IMP	biological process
GO:0036064	ciliary basal body	IMP	cellular component
GO:0050321	tau-protein kinase activity	IBA	molecular function
GO:0000226	microtubule cytoskeleton organization	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0030425	dendrite	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0050321	tau-protein kinase activity	IMP	molecular function
GO:0006468	protein phosphorylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0030030	cell projection organization	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0097711	ciliary basal body-plasma membrane docking	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0043015	gamma-tubulin binding	IDA	molecular function
GO:0007399	nervous system development	IDA	biological process
GO:0005815	microtubule organizing center	IDA	cellular component
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0050321	tau-protein kinase activity	IDA	molecular function
GO:0043005	neuron projection	IDA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0008017	microtubule binding	IDA	molecular function
GO:0005813	centrosome	IDA	cellular component
GO:0001578	microtubule bundle formation	IEP	biological process
GO:0000226	microtubule cytoskeleton organization	IMP	biological process
GO:0043068	positive regulation of programmed cell death	NAS	biological process
GO:0043130	ubiquitin binding	NAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0005524	ATP binding	NAS	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq