• Gene id: 5778

Gene Summary

• Gene Symbol: PTPN7   Gene   UCSC   Ensembl
• Aliases: BPTP-4, HEPTP, LC-PTP, LPTP, PTPNI
• Gene name: protein tyrosine phosphatase non-receptor type 7
• Alternate names: tyrosine-protein phosphatase non-receptor type 7, dual specificity phosphatase 1, hematopoietic protein-tyrosine phosphatase, protein-tyrosine phosphatase LC-PTP, protein-tyrosine phosphatase, nonreceptor-type, stress induced,
• Gene location: 1q32.1 (202161587: 202147011)     Exons: 13     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic tran
• OMIM: 109170

Protein Summary

• Protein general information: P35236  
  • Name: Tyrosine protein phosphatase non receptor type 7 (EC 3.1.3.48) (Hematopoietic protein tyrosine phosphatase) (HEPTP) (Protein tyrosine phosphatase LC PTP)
  • Length: 360  
  • Mass: 40529
  • Tissue specificity: Expressed exclusively in thymus and spleen. {ECO
• Sequence:

  MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEPICSVNTPREVTLHFL
  RTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPNPQSRVCLGRAQSQEDGDYI
  NANYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDM
  KECPEYTVRQLTIQYQEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGC
  FIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP

• Structural information:
  • Protein Domains: (97..35-)
    (/note="Tyrosine-protein-phosphatase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00160"-)
  • Interpro: IPR029021  IPR000242  IPR016130  IPR003595  IPR008356   IPR000387  
  • Prosite: PS00383 PS50056 PS50055
  • PDB: 1ZC0 2A3K 2GP0 2GPH 2HVL 2QDC 2QDM 2QDP 3D42 3D44 3O4S 3O4T 3O4U
  • PDBsum: 1ZC0 2A3K 2GP0 2GPH 2HVL 2QDC 2QDM 2QDP 3D42 3D44 3O4S 3O4T 3O4U
  • DIP: 29118
  • STRING: ENSP00000309116
• Other Databases: GeneCards:  PTPN7  Malacards:  PTPN7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006470	protein dephosphorylation	IBA	biological process
GO:0004725	protein tyrosine phosphatase activity	IBA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016791	phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004725	protein tyrosine phosphatase activity	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0006470	protein dephosphorylation	TAS	biological process
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0071345	cellular response to cytokine stimulus	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0009898	cytoplasmic side of plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881