• Gene id: 57763

Gene Summary

• Gene Symbol: ANKRA2   Gene   UCSC   Ensembl
• Aliases: ANKRA
• Gene name: ankyrin repeat family A member 2
• Alternate names: ankyrin repeat family A protein 2, RFXANK-like protein 2, ankyrin repeat, family A (RFXANK-like), 2,
• Gene location: 5q13.2 (73565638: 73552189)     Exons: 9     NC_000005.10
• OMIM: 606794

Protein Summary

• Protein general information: Q9H9E1  
  • Name: Ankyrin repeat family A protein 2 (RFXANK like protein 2)
  • Length: 313  
  • Mass: 34272
• Sequence:

  MDTSTNLDIGAQLIVEECPSTYSLTGMPDIKIEHPLDPNSEEGSAQGVAMGMKFILPNRFDMNVCSRFVKSLNEE
  DSKNIQDQVNSDLEVASVLFKAECNIHTSPSPGIQVRHVYTPSTTKHFSPIKQSTTLTNKHRGNEVSTTPLLANS
  LSVHQLAAQGEMLYLATRIEQENVINHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSK
  GYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSVQQVI
  ESHLLKLLQNIKE

• Structural information:
  • Interpro: IPR002110  IPR020683  IPR036770  
  • Prosite: PS50297 PS50088
  • PDB: 3SO8 3V2O 3V2X 3V31 4LG6 4QQI
  • PDBsum: 3SO8 3V2O 3V2X 3V31 4LG6 4QQI
  • STRING: ENSP00000296785
• Other Databases: GeneCards:  ANKRA2  Malacards:  ANKRA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0031625	ubiquitin protein ligase binding	IDA	molecular function
GO:0043254	regulation of protein-containing complex assembly	IDA	biological process
GO:1990393	3M complex	IDA	colocalizes with
GO:0042826	histone deacetylase binding	IDA	molecular function
GO:0050750	low-density lipoprotein particle receptor binding	IPI	molecular function
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042826	histone deacetylase binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0031625	ubiquitin protein ligase binding	IDA	molecular function
GO:0043254	regulation of protein-containing complex assembly	IDA	biological process
GO:1990393	3M complex	IDA	colocalizes with
GO:0042826	histone deacetylase binding	IDA	molecular function
GO:0050750	low-density lipoprotein particle receptor binding	IPI	molecular function
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042826	histone deacetylase binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0019901	protein kinase binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881