• Gene id: 5775

Gene Summary

• Gene Symbol: PTPN4   Gene   UCSC   Ensembl
• Aliases: MEG, PTPMEG, PTPMEG1
• Gene name: protein tyrosine phosphatase non-receptor type 4
• Alternate names: tyrosine-protein phosphatase non-receptor type 4, PTPase-MEG1, megakaryocyte phosphatase, megakaryocyte protein-tyrosine phosphatase, protein tyrosine phosphatase MEG1, protein tyrosine phosphatase, non-receptor type 4 (megakaryocyte),
• Gene location: 2q14.2 (119759921: 119984898)     Exons: 27     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic tran
• OMIM: 608428

Protein Summary

• Protein general information: P29074  
  • Name: Tyrosine protein phosphatase non receptor type 4 (EC 3.1.3.48) (Protein tyrosine phosphatase MEG1) (MEG) (PTPase MEG1)
  • Length: 926  
  • Mass: 105911
• Sequence:

  MTSRFRLPAGRTYNVRASELARDRQHTEVVCNILLLDNTVQAFKVNKHDQGQVLLDVVFKHLDLTEQDYFGLQLA
  DDSTDNPRWLDPNKPIRKQLKRGSPYSLNFRVKFFVSDPNKLQEEYTRYQYFLQIKQDILTGRLPCPSNTAALLA
  SFAVQSELGDYDQSENLSGYLSDYSFIPNQPQDFEKEIAKLHQQHIGLSPAEAEFNYLNTARTLELYGVEFHYAR
  DQSNNEIMIGVMSGGILIYKNRVRMNTFPWLKIVKISFKCKQFFIQLRKELHESRETLLGFNMVNYRACKNLWKA
  CVEHHTFFRLDRPLPPQKNFFAHYFTLGSKFRYCGRTEVQSVQYGKEKANKDRVFARSPSKPLARKLMDWEVVSR
  NSISDDRLETQSLPSRSPPGTPNHRNSTFTQEGTRLRPSSVGHLVDHMVHTSPSEVFVNQRSPSSTQANSIVLES
  SPSQETPGDGKPPALPPKQSKKNSWNQIHYSHSQQDLESHINETFDIPSSPEKPTPNGGIPHDNLVLIRMKPDEN
  GRFGFNVKGGYDQKMPVIVSRVAPGTPADLCVPRLNEGDQVVLINGRDIAEHTHDQVVLFIKASCERHSGELMLL
  VRPNAVYDVVEEKLENEPDFQYIPEKAPLDSVHQDDHSLRESMIQLAEGLITGTVLTQFDQLYRKKPGMTMSCAK
  LPQNISKNRYRDISPYDATRVILKGNEDYINANYINMEIPSSSIINQYIACQGPLPHTCTDFWQMTWEQGSSMVV
  MLTTQVERGRVKCHQYWPEPTGSSSYGCYQVTCHSEEGNTAYIFRKMTLFNQEKNESRPLTQIQYIAWPDHGVPD
  DSSDFLDFVCHVRNKRAGKEEPVVVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQ
  YRFVCEAILKVYEEGFVKPLTTSTNK

• Structural information:
  • Protein Domains: (29..31-)
    (/note="FERM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00084-)
    (517..58-)
    (/note="PDZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143-)
    (655..91-)
    (/note="Tyrosine-protein-phosphatase)
    (/evidence="ECO:0000255|PROSITE-Pro-)
  • Interpro: IPR019749  IPR014847  IPR014352  IPR035963  IPR019748   IPR019747  IPR000299  IPR018979  IPR018980  IPR001478  IPR036034  IPR011993  IPR029021  IPR000242  IPR041783  IPR016130  IPR003595  IPR012151  IPR000387  IPR029071  
  • Prosite: PS00660 PS00661 PS50057 PS50106 PS00383 PS50056 PS50055
  • CDD: cd14473 cd13189
  • PDB: 2CS5 2I75 2VPH 3NFK 3NFL 5EYZ 5EZ0
  • PDBsum: 2CS5 2I75 2VPH 3NFK 3NFL 5EYZ 5EZ0
  • DIP: 34634
  • STRING: ENSP00000263708
• Other Databases: GeneCards:  PTPN4  Malacards:  PTPN4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009898	cytoplasmic side of plasma membrane	IBA	cellular component
GO:0004725	protein tyrosine phosphatase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0008092	cytoskeletal protein binding	IEA	molecular function
GO:0016311	dephosphorylation	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016791	phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004726	non-membrane spanning protein tyrosine phosphatase activity	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0006470	protein dephosphorylation	TAS	biological process
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0071345	cellular response to cytokine stimulus	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004726	non-membrane spanning protein tyrosine phosphatase activity	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0009898	cytoplasmic side of plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R