• Gene id: 57727

Gene Summary

• Gene Symbol: NCOA5   Gene   UCSC   Ensembl
• Aliases: CIA, bA465L10.6
• Gene name: nuclear receptor coactivator 5
• Alternate names: nuclear receptor coactivator 5, NCoA-5, coactivator independent of AF-2,
• Gene location: 20q13.12 (46089961: 46060990)     Exons: 8     NC_000020.11
• Gene summary(Entrez): This gene encodes a coregulator for the alpha and beta estrogen receptors and the orphan nuclear receptor NR1D2. The protein localizes to the nucleus, and is thought to have both coactivator and corepressor functions. Its interaction with nuclear receptor
• OMIM: 606900

Protein Summary

• Protein general information: Q9HCD5  
  • Name: Nuclear receptor coactivator 5 (NCoA 5) (Coactivator independent of AF 2) (CIA)
  • Length: 579  
  • Mass: 65536
  • Tissue specificity: Widely expressed.
• Sequence:

  MNTAPSRPSPTRRDPYGFGDSRDSRRDRSPIRGSPRREPRDGRNGRDARDSRDIRDPRDLRDHRHSRDLRDHRDS
  RSVRDVRDVRDLRDFRDLRDSRDFRDQRDPMYDRYRDMRDSRDPMYRREGSYDRYLRMDDYCRRKDDSYFDRYRD
  SFDGRGPPGPESQSRAKERLKREERRREELYRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGM
  VVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNE
  CREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEETDKIINYLRERKERLM
  RSSTDSLPGPISRQPLGATSGASLKTQPSSQPLQSGQVLPSATPTPSAPPTSQQELQAKILSLFNSGTVTANSSS
  ASPSVAAGNTPNQNFSTAANSQPQQRSQASGNQPPSILGQGGSAQNMGPRPGAPSQGLFGQPSSRLAPASNMTSQ
  RPVSSTGINFDNPSVQKALDTLIQSGPALSHLVSQTTAQMGQPQAPMGSYQRHY

• Structural information:
  • Interpro: IPR036621  
  • PDB: 1V95 2J7X 2J7Y 4ZI1
  • PDBsum: 1V95 2J7X 2J7Y 4ZI1
  • STRING: ENSP00000290231
• Other Databases: GeneCards:  NCOA5  Malacards:  NCOA5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0046627	negative regulation of insulin receptor signaling pathway	IEA	biological process
GO:0042593	glucose homeostasis	IEA	biological process
GO:0003682	chromatin binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0005615	extracellular space	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Male infertility	MIK: 31664153
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31664153	Male infertility				Male infertility