• Gene id: 57715

Gene Summary

• Gene Symbol: SEMA4G   Gene   UCSC   Ensembl
• Gene name: semaphorin 4G
• Alternate names: semaphorin-4G, sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4G,
• Gene location: 10q24.31 (196651877: 196747503)     Exons: 25     NC_000001.11
• Gene summary(Entrez): Semaphorins are a large family of conserved secreted and membrane associated proteins which possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Based on sequence and st

Protein Summary

• Protein general information: Q9NTN9  
  • Name: Semaphorin 4G
  • Length: 838  
  • Mass: 91497
• Sequence:

  MWGRLWPLLLSILTATAVPGPSLRRPSRELDATPRMTIPYEELSGTRHFKGQAQNYSTLLLEEASARLLVGARGA
  LFSLSANDIGDGAHKEIHWEASPEMQSKCHQKGKNNQTECFNHVRFLQRLNSTHLYACGTHAFQPLCAAIDAEAF
  TLPTSFEEGKEKCPYDPARGFTGLIIDGGLYTATRYEFRSIPDIRRSRHPHSLRTEETPMHWLNDAEFVFSVLVR
  ESKASAVGDDDKVYYFFTERATEEGSGSFTQSRSSHRVARVARVCKGDLGGKKILQKKWTSFLKARLICHIPLYE
  TLRGVCSLDAETSSRTHFYAAFTLSTQWKTLEASAICRYDLAEIQAVFAGPYMEYQDGSRRWGRYEGGVPEPRPG
  SCITDSLRSQGYNSSQDLPSLVLDFVKLHPLMARPVVPTRGRPLLLKRNIRYTHLTGTPVTTPAGPTYDLLFLGT
  ADGWIHKAVVLGSGMHIIEETQVFRESQSVENLVISLLQHSLYVGAPSGVIQLPLSSCSRYRSCYDCILARDPYC
  GWDPGTHACAAATTIANRTALIQDIERGNRGCESSRDTGPPPPLKTRSVLRGDDVLLPCDQPSNLARALWLLNGS
  MGLSDGQGGYRVGVDGLLVTDAQPEHSGNYGCYAEENGLRTLLASYSLTVRPATPAPAPKAPATPGAQLAPDVRL
  LYVLAIAALGGLCLILASSLLYVACLREGRRGRRRKYSLGRASRAGGSAVQLQTVSGQCPGEEDEGDDEGAGGLE
  GSCLQIIPGEGAPAPPPPPPPPPPAELTNGLVALPSRLRRMNGNSYVLLRQSNNGVPAGPCSFAEELSRILEKRK
  HTQLVEQLDESSV

• Structural information:
  • Protein Domains: (35..50-)
    (/note="Sema-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00352-)
    (507..55-)
    (/note="PSI-)
    (567..64-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR002165   IPR016201  IPR001627  IPR036352  IPR027231  IPR015943  
  • Prosite: PS50835 PS51004
  • STRING: ENSP00000210633
• Other Databases: GeneCards:  SEMA4G  Malacards:  SEMA4G

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030215	semaphorin receptor binding	IEA	molecular function
GO:0001755	neural crest cell migration	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007411	axon guidance	IBA	biological process
GO:0048843	negative regulation of axon extension involved in axon guidance	IBA	biological process
GO:0050919	negative chemotaxis	IBA	biological process
GO:0071526	semaphorin-plexin signaling pathway	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0030215	semaphorin receptor binding	IBA	molecular function
GO:0030335	positive regulation of cell migration	IBA	biological process
GO:0045499	chemorepellent activity	IBA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)