• Gene id: 5771

Gene Summary

• Gene Symbol: PTPN2   Gene   UCSC   Ensembl
• Aliases: PTN2, PTPT, TC-PTP, TCELLPTP, TCPTP
• Gene name: protein tyrosine phosphatase non-receptor type 2
• Alternate names: tyrosine-protein phosphatase non-receptor type 2, T-cell protein tyrosine phosphatase,
• Gene location: 18p11.21 (12884350: 12785477)     Exons: 15     NC_000018.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. Members of the PTP family share a highly conserved catalytic motif, which is essential for the catalytic activity. PTPs are known to be signaling molecules that
• OMIM: 176887

Protein Summary

• Protein general information: P17706  
  • Name: Tyrosine protein phosphatase non receptor type 2 (EC 3.1.3.48) (T cell protein tyrosine phosphatase) (TCPTP)
  • Length: 415  
  • Mass: 48473
  • Tissue specificity: Ubiquitously expressed. Isoform 2 is probably the major isoform. Isoform 1 is expressed in T-cells and in placenta. {ECO
• Sequence:

  MPTTIEREFEELDTQRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVKLQNAENDYINASLVD
  IEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKESVKCAQYWPTDDQEMLFKETGFSVKLLSEDV
  KSYYTVHLLQLENINSGETRTISHFHYTTWPDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAGIGRSGT
  FSLVDTCLVLMEKGDDINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSSIQKRWKELSKEDLSPA
  FDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSESALRKRIREDRKATTAQKVQQMKQRLNEN
  ERKRKRWLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL

• Structural information:
  • Protein Domains: (5..27-)
    (/note="Tyrosine-protein-phosphatase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00160"-)
  • Interpro: IPR029021  IPR000242  IPR012265  IPR016130  IPR003595   IPR000387  
  • Prosite: PS00383 PS50056 PS50055
  • PDB: 1L8K
  • PDBsum: 1L8K
  • STRING: ENSP00000311857
• Other Databases: GeneCards:  PTPN2  Malacards:  PTPN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IDA	cellular component
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	colocalizes with
GO:1902233	negative regulation of positive thymic T cell selection	ISS	biological process
GO:1902202	regulation of hepatocyte growth factor receptor signaling pathway	IMP	biological process
GO:0045722	positive regulation of gluconeogenesis	ISS	biological process
GO:0045650	negative regulation of macrophage differentiation	ISS	biological process
GO:0042593	glucose homeostasis	ISS	biological process
GO:0030218	erythrocyte differentiation	ISS	biological process
GO:0030183	B cell differentiation	ISS	biological process
GO:0010888	negative regulation of lipid storage	ISS	biological process
GO:0010804	negative regulation of tumor necrosis factor-mediated signaling pathway	ISS	biological process
GO:0008286	insulin receptor signaling pathway	ISS	biological process
GO:0008285	negative regulation of cell population proliferation	IMP	biological process
GO:0004725	protein tyrosine phosphatase activity	IMP	molecular function
GO:0004725	protein tyrosine phosphatase activity	IMP	molecular function
GO:2000587	negative regulation of platelet-derived growth factor receptor-beta signaling pathway	ISS	biological process
GO:1902227	negative regulation of macrophage colony-stimulating factor signaling pathway	ISS	biological process
GO:1902206	negative regulation of interleukin-2-mediated signaling pathway	IMP	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0060339	negative regulation of type I interferon-mediated signaling pathway	IMP	biological process
GO:0060336	negative regulation of interferon-gamma-mediated signaling pathway	ISS	biological process
GO:0050922	negative regulation of chemotaxis	ISS	biological process
GO:0050860	negative regulation of T cell receptor signaling pathway	ISS	biological process
GO:0050728	negative regulation of inflammatory response	ISS	biological process
GO:0046627	negative regulation of insulin receptor signaling pathway	ISS	biological process
GO:0042532	negative regulation of tyrosine phosphorylation of STAT protein	IMP	biological process
GO:0042059	negative regulation of epidermal growth factor receptor signaling pathway	IMP	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IMP	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IMP	biological process
GO:0030971	receptor tyrosine kinase binding	IPI	molecular function
GO:0030217	T cell differentiation	ISS	biological process
GO:0019905	syntaxin binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005178	integrin binding	IPI	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016791	phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0004725	protein tyrosine phosphatase activity	EXP	molecular function
GO:0060334	regulation of interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0071345	cellular response to cytokine stimulus	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1902233	negative regulation of positive thymic T cell selection	IEA	biological process
GO:1902215	negative regulation of interleukin-4-mediated signaling pathway	IEA	biological process
GO:0097677	STAT family protein binding	IEA	molecular function
GO:0045722	positive regulation of gluconeogenesis	IEA	biological process
GO:0045650	negative regulation of macrophage differentiation	IEA	biological process
GO:0042593	glucose homeostasis	IEA	biological process
GO:0030218	erythrocyte differentiation	IEA	biological process
GO:0030183	B cell differentiation	IEA	biological process
GO:0010888	negative regulation of lipid storage	IEA	biological process
GO:0010804	negative regulation of tumor necrosis factor-mediated signaling pathway	IEA	biological process
GO:0008286	insulin receptor signaling pathway	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0004726	non-membrane spanning protein tyrosine phosphatase activity	IEA	molecular function
GO:2000587	negative regulation of platelet-derived growth factor receptor-beta signaling pathway	IEA	biological process
GO:1903899	positive regulation of PERK-mediated unfolded protein response	IEA	biological process
GO:1902237	positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IEA	biological process
GO:1902227	negative regulation of macrophage colony-stimulating factor signaling pathway	IEA	biological process
GO:1902206	negative regulation of interleukin-2-mediated signaling pathway	IEA	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0070104	negative regulation of interleukin-6-mediated signaling pathway	IEA	biological process
GO:0061099	negative regulation of protein tyrosine kinase activity	IEA	biological process
GO:0060339	negative regulation of type I interferon-mediated signaling pathway	IEA	biological process
GO:0060336	negative regulation of interferon-gamma-mediated signaling pathway	IEA	biological process
GO:0050922	negative regulation of chemotaxis	IEA	biological process
GO:0050860	negative regulation of T cell receptor signaling pathway	IEA	biological process
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0046627	negative regulation of insulin receptor signaling pathway	IEA	biological process
GO:0042532	negative regulation of tyrosine phosphorylation of STAT protein	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0030217	T cell differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04630	JAK-STAT signaling pathway

Diseases

Associated diseases	References
Type 1 diabetes mellitus	KEGG:H00408
Type 1 diabetes mellitus	KEGG:H00408
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)