• Gene id: 57707

Gene Summary

• Gene Symbol: MEAK7   Gene   UCSC   Ensembl
• Aliases: KIAA1609, TLDC1, mEAK-7
• Gene name: MTOR associated protein, eak-7 homolog
• Alternate names: MTOR-associated protein MEAK7, TBC/LysM-associated domain containing 1, TBC/LysM-associated domain-containing protein 1, TLD domain containing 1, TLD domain-containing protein 1, mammalian EAK-7,
• Gene location: 16q24.1 (84504707: 84476354)     Exons: 12     NC_000016.10

Protein Summary

• Protein general information: Q6P9B6  
  • Name: MTOR associated protein MEAK7 (MEAK7) (MTOR associated protein, eak 7 homolog) (TBC/LysM associated domain containing protein 1) (TLD domain containing protein 1)
  • Length: 456  
  • Mass: 50994
• Sequence:

  MGNSRSRVGRSFCSQFLPEEQAEIDQLFDALSSDKNSPNVSSKSFSLKALQNHVGEALPPEMVTRLYDGMRRVDL
  TGKAKGPSENVSQEQFTASMSHLLKGNSEEKSLMIMKMISATEGPVKAREVQKFTEDLVGSVVHVLSHRQELRGW
  TGKEAPGPNPRVQVLAAQLLSDMKLQDGKRLLGPQWLDYDCDRAVIEDWVFRVPHVAIFLSVVICKGFLILCSSL
  DLTTLVPERQVDQGRGFESILDVLSVMYINAQLPREQRHRWCLLFSSELHGHSFSQLCGHITHRGPCVAVLEDHD
  KHVFGGFASCSWEVKPQFQGDNRCFLFSICPSMAVYTHTGYNDHYMYLNHGQQTIPNGLGMGGQHNYFGLWVDVD
  FGKGHSRAKPTCTTYNSPQLSAQENFQFDKMEVWAVGDPSEEQLAKGNKSILDADPEAQALLEISGHSRHSEGLR
  EVPDDE

• Structural information:
  • Protein Domains: (244..41-)
    (/note="TLDc-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01234"-)
  • Interpro: IPR006571  
  • Prosite: PS51886
  • STRING: ENSP00000343635
• Other Databases: GeneCards:  MEAK7  Malacards:  MEAK7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032868	response to insulin	IDA	biological process
GO:0150032	positive regulation of protein localization to lysosome	IDA	biological process
GO:0030334	regulation of cell migration	IDA	biological process
GO:0042127	regulation of cell population proliferation	IDA	biological process
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0031667	response to nutrient levels	IDA	biological process
GO:0043200	response to amino acid	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0031929	TOR signaling	IMP	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1903204	negative regulation of oxidative stress-induced neuron death	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005765	lysosomal membrane	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)