Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 5770
Gene Summary     SNPs    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol PTPN1   Gene   UCSC   Ensembl
Aliases PTP1B
Gene name protein tyrosine phosphatase non-receptor type 1
Alternate names tyrosine-protein phosphatase non-receptor type 1, protein tyrosine phosphatase, placental, protein-tyrosine phosphatase 1B,
Gene location 20q13.13 (50510320: 50585240)     Exons: 10     NC_000020.11
Gene summary(Entrez) The protein encoded by this gene is the founding member of the protein tyrosine phosphatase (PTP) family, which was isolated and identified based on its enzymatic activity and amino acid sequence. PTPs catalyze the hydrolysis of the phosphate monoesters s
OMIM 176885

SNPs
rs7099208

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000010.11   g.114894815A>G
NC_000010.10   g.116654574A>G|SEQ=[A/G]|GENE=FAM160B1

Protein Summary
Protein general information P18031  

Name: Tyrosine protein phosphatase non receptor type 1 (EC 3.1.3.48) (Protein tyrosine phosphatase 1B) (PTP 1B)

Length: 435  Mass: 49967

Tissue specificity: Expressed in keratinocytes (at protein level). {ECO

Sequence MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKME
EAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIK
SYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTF
CLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLE
PPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVV
GGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT
Structural information
Protein Domains
 (3..27-)
(/note="Tyrosine-protein-phosphatase)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00160"-)
Interpro:  IPR029021  IPR000242  IPR012265  IPR016130  IPR003595  
IPR000387  
Prosite:   PS00383 PS50056 PS50055

PDB:  		 1A5Y 1AAX 1BZC 1BZH 1BZJ 1C83 1C84 1C85 1C86 1C87 1C88 1ECV 1EEN 1EEO 1G1F 1G1G 1G1H 1G7F 1G7G 1GFY 1I57 1JF7 1KAK 1KAV 1L8G 1LQF 1NL9 1NNY 1NO6 1NWE 1NWL 1NZ7 1OEM 1OEO 1OES 1OET 1OEU 1OEV 1ONY 1ONZ 1PA1 1PH0 1PTT 1PTU 1PTV 1PTY 1PXH 1PYN 1Q1M 1Q6J 1Q6M 1Q6N 1Q6P 1Q6S 1Q6T 1QXK 1SUG 1T48 1T49 1T4J 1WAX 1XBO 2AZR 2B0
PDBsum:   1A5Y 1AAX 1BZC 1BZH 1BZJ 1C83 1C84 1C85 1C86 1C87 1C88 1ECV 1EEN 1EEO 1G1F 1G1G 1G1H 1G7F 1G7G 1GFY 1I57 1JF7 1KAK 1KAV 1L8G 1LQF 1NL9 1NNY 1NO6 1NWE 1NWL 1NZ7 1OEM 1OEO 1OES 1OET 1OEU 1OEV 1ONY 1ONZ 1PA1 1PH0 1PTT 1PTU 1PTV 1PTY 1PXH 1PYN 1Q1M 1Q6J 1Q6M 1Q6N 1Q6P 1Q6S 1Q6T 1QXK 1SUG 1T48 1T49 1T4J 1WAX 1XBO 2AZR 2B0

DIP:  
38014
MINT:  
STRING:   ENSP00000360683
Other Databases GeneCards:  PTPN1  Malacards:  PTPN1

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0098554 cytoplasmic side of endop
lasmic reticulum membrane
 IDA cellular component
GO:1903898 negative regulation of PE
RK-mediated unfolded prot
ein response
 IDA biological process
GO:1903896 positive regulation of IR
E1-mediated unfolded prot
ein response
 TAS biological process
GO:0061098 positive regulation of pr
otein tyrosine kinase act
ivity
 IDA biological process
GO:0034620 cellular response to unfo
lded protein
 TAS biological process
GO:0043407 negative regulation of MA
P kinase activity
 IMP biological process
GO:2000646 positive regulation of re
ceptor catabolic process
 IMP biological process
GO:0006470 protein dephosphorylation
 IMP biological process
GO:0033157 regulation of intracellul
ar protein transport
 IMP biological process
GO:0030968 endoplasmic reticulum unf
olded protein response
 IDA biological process
GO:0004725 protein tyrosine phosphat
ase activity
 IDA molecular function
GO:0035335 peptidyl-tyrosine dephosp
horylation
 IDA biological process
GO:0030100 regulation of endocytosis
 IDA biological process
GO:0005886 plasma membrane
 IDA colocalizes with
GO:0005769 early endosome
 IDA cellular component
GO:1902202 regulation of hepatocyte
growth factor receptor si
gnaling pathway
 IMP biological process
GO:0046875 ephrin receptor binding
 IPI molecular function
GO:0035791 platelet-derived growth f
actor receptor-beta signa
ling pathway
 IMP biological process
GO:0035335 peptidyl-tyrosine dephosp
horylation
 IMP biological process
GO:0031532 actin cytoskeleton reorga
nization
 IMP biological process
GO:0030971 receptor tyrosine kinase
binding
 IPI molecular function
GO:0019901 protein kinase binding
 IPI molecular function
GO:0019899 enzyme binding
 IPI molecular function
GO:0009966 regulation of signal tran
sduction
 IMP biological process
GO:0004725 protein tyrosine phosphat
ase activity
 IEA molecular function
GO:0006470 protein dephosphorylation
 IEA biological process
GO:0016311 dephosphorylation
 IEA biological process
GO:0016791 phosphatase activity
 IEA molecular function
GO:0004721 phosphoprotein phosphatas
e activity
 IEA molecular function
GO:0016787 hydrolase activity
 IEA molecular function
GO:0005783 endoplasmic reticulum
 IEA cellular component
GO:0016020 membrane
 IEA cellular component
GO:0004725 protein tyrosine phosphat
ase activity
 IEA molecular function
GO:0032991 protein-containing comple
x
 IDA cellular component
GO:0004725 protein tyrosine phosphat
ase activity
 IDA molecular function
GO:0060338 regulation of type I inte
rferon-mediated signaling
pathway
 TAS biological process
GO:0060397 growth hormone receptor s
ignaling pathway via JAK-
STAT
 TAS biological process
GO:0004725 protein tyrosine phosphat
ase activity
 TAS molecular function
GO:0004725 protein tyrosine phosphat
ase activity
 TAS molecular function
GO:0004725 protein tyrosine phosphat
ase activity
 TAS molecular function
GO:0004725 protein tyrosine phosphat
ase activity
 TAS molecular function
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0009968 negative regulation of si
gnal transduction
 TAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0046626 regulation of insulin rec
eptor signaling pathway
 IEA biological process
GO:0031410 cytoplasmic vesicle
 IEA cellular component
GO:0006470 protein dephosphorylation
 IEA biological process
GO:0005829 cytosol
 IEA cellular component
GO:0004725 protein tyrosine phosphat
ase activity
 IEA molecular function
GO:1990264 peptidyl-tyrosine dephosp
horylation involved in in
activation of protein kin
ase activity
 IEA biological process
GO:1903898 negative regulation of PE
RK-mediated unfolded prot
ein response
 IEA biological process
GO:1902236 negative regulation of en
doplasmic reticulum stres
s-induced intrinsic apopt
otic signaling pathway
 IEA biological process
GO:0097443 sorting endosome
 IEA cellular component
GO:0030948 negative regulation of va
scular endothelial growth
factor receptor signalin
g pathway
 IEA biological process
GO:0008286 insulin receptor signalin
g pathway
 IEA biological process
GO:0007257 activation of JUN kinase
activity
 IEA biological process
GO:0006470 protein dephosphorylation
 IEA biological process
GO:0051721 protein phosphatase 2A bi
nding
 IEA molecular function
GO:0030061 mitochondrial crista
 IEA cellular component
GO:0005759 mitochondrial matrix
 IEA cellular component
GO:0005158 insulin receptor binding
 IEA molecular function
GO:0070373 negative regulation of ER
K1 and ERK2 cascade
 IEA biological process
GO:0036498 IRE1-mediated unfolded pr
otein response
 IEA biological process
GO:0035791 platelet-derived growth f
actor receptor-beta signa
ling pathway
 IEA biological process
GO:0035335 peptidyl-tyrosine dephosp
horylation
 IEA biological process
GO:0034976 response to endoplasmic r
eticulum stress
 IEA biological process
GO:0005769 early endosome
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0045296 cadherin binding
 HDA molecular function
GO:0030948 negative regulation of va
scular endothelial growth
factor receptor signalin
g pathway
 ISS biological process
GO:0097443 sorting endosome
 ISS cellular component
GO:1990264 peptidyl-tyrosine dephosp
horylation involved in in
activation of protein kin
ase activity
 ISS biological process
GO:0046627 negative regulation of in
sulin receptor signaling
pathway
 NAS biological process
GO:0070373 negative regulation of ER
K1 and ERK2 cascade
 ISS biological process
GO:0005789 endoplasmic reticulum mem
brane
 IEA cellular component
GO:0005783 endoplasmic reticulum
 IDA cellular component
GO:0008270 zinc ion binding
 IDA molecular function
GO:0004725 protein tyrosine phosphat
ase activity
 IDA molecular function
GO:0003723 RNA binding
 HDA molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04910Insulin signaling pathway
hsa04931Insulin resistance
hsa04520Adherens junction

Diseases

Expand All | Collapse All
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract