• Gene id: 577

Gene Summary

• Gene Symbol: ADGRB3   Gene   UCSC   Ensembl
• Aliases: BAI3
• Gene name: adhesion G protein-coupled receptor B3
• Alternate names: adhesion G protein-coupled receptor B3, brain-specific angiogenesis inhibitor 3, dJ91B17.1 (brain-specific angiogenesis inhibitor 3),
• Gene location: 6q12-q13 (68635281: 69389505)     Exons: 1     NC_000006.12
• Gene summary(Entrez): This p53-target gene encodes a brain-specific angiogenesis inhibitor, a seven-span transmembrane protein, and is thought to be a member of the secretin receptor family. Brain-specific angiogenesis proteins BAI2 and BAI3 are similar to BAI1 in structure, h
• OMIM: 602684

SNPs

rs780798708

Strand:    Allele origin:   Allele change:   Mutation type: del

NC_000003.12   g.113380945_113380946del
NC_000003.11   g.113099792_113099793del
NM_018338.3   c.2005_2006del
NM_001164496.2   c.2005_2006del
NM_001164496.1   c.2005_2006del
NP_060808.2   p.Met669fs
NP_001157968.1   p.Met669fs|SEQ=[AT/-]|GENE=CFAP44

rs7099208

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000010.11   g.114894815A>G
NC_000010.10   g.116654574A>G|SEQ=[A/G]|GENE=FAM160B1

Protein Summary

• Protein general information: O60242  
  • Name: Adhesion G protein coupled receptor B3 (Brain specific angiogenesis inhibitor 3)
  • Length: 1522  
  • Mass: 171518
  • Tissue specificity: Strongly expressed in brain. Also detected in heart. Reduced expression in some glioblastoma cell lines. {ECO
• Sequence:

  MKAVRNLLIYIFSTYLLVMFGFNAAQDFWCSTLVKGVIYGSYSVSEMFPKNFTNCTWTLENPDPTKYSIYLKFSK
  KDLSCSNFSLLAYQFDHFSHEKIKDLLRKNHSIMQLCNSKNAFVFLQYDKNFIQIRRVFPTNFPGLQKKGEEDQK
  SFFEFLVLNKVSPSQFGCHVLCTWLESCLKSENGRTESCGIMYTKCTCPQHLGEWGIDDQSLILLNNVVLPLNEQ
  TEGCLTQELQTTQVCNLTREAKRPPKEEFGMMGDHTIKSQRPRSVHEKRVPQEQADAAKFMAQTGESGVEEWSQW
  STCSVTCGQGSQVRTRTCVSPYGTHCSGPLRESRVCNNTALCPVHGVWEEWSPWSLCSFTCGRGQRTRTRSCTPP
  QYGGRPCEGPETHHKPCNIALCPVDGQWQEWSSWSQCSVTCSNGTQQRSRQCTAAAHGGSECRGPWAESRECYNP
  ECTANGQWNQWGHWSGCSKSCDGGWERRIRTCQGAVITGQQCEGTGEEVRRCNEQRCPAPYEICPEDYLMSMVWK
  RTPAGDLAFNQCPLNATGTTSRRCSLSLHGVAFWEQPSFARCISNEYRHLQHSIKEHLAKGQRMLAGDGMSQVTK
  TLLDLTQRKNFYAGDLLMSVEILRNVTDTFKRASYIPASDGVQNFFQIVSNLLDEENKEKWEDAQQIYPGSIELM
  QVIEDFIHIVGMGMMDFQNSYLMTGNVVASIQKLPAASVLTDINFPMKGRKGMVDWARNSEDRVVIPKSIFTPVS
  SKELDESSVFVLGAVLYKNLDLILPTLRNYTVINSKIIVVTIRPEPKTTDSFLEIELAHLANGTLNPYCVLWDDS
  KTNESLGTWSTQGCKTVLTDASHTKCLCDRLSTFAILAQQPREIIMESSGTPSVTLIVGSGLSCLALITLAVVYA
  ALWRYIRSERSIILINFCLSIISSNILILVGQTQTHNKSICTTTTAFLHFFFLASFCWVLTEAWQSYMAVTGKIR
  TRLIRKRFLCLGWGLPALVVATSVGFTRTKGYGTDHYCWLSLEGGLLYAFVGPAAAVVLVNMVIGILVFNKLVSR
  DGILDKKLKHRAGQMSEPHSGLTLKCAKCGVVSTTALSATTASNAMASLWSSCVVLPLLALTWMSAVLAMTDKRS
  ILFQILFAVFDSLQGFVIVMVHCILRREVQDAFRCRLRNCQDPINADSSSSFPNGHAQIMTDFEKDVDIACRSVL
  HKDIGPCRAATITGTLSRISLNDDEEEKGTNPEGLSYSTLPGNVISKVIIQQPTGLHMPMSMNELSNPCLKKENS
  ELRRTVYLCTDDNLRGADMDIVHPQERMMESDYIVMPRSSVNNQPSMKEESKMNIGMETLPHERLLHYKVNPEFN
  MNPPVMDQFNMNLEQHLAPQEHMQNLPFEPRTAVKNFMASELDDNAGLSRSETGSTISMSSLERRKSRYSDLDFE
  KVMHTRKRHMELFQELNQKFQTLDRFRDIPNTSSMENPAPNKNPWDTFKNPSEYPHYTTINVLDTEAKDALELRP
  AEWEKCLNLPLDVQEGDFQTEV

• Structural information:
  • Protein Domains: (30..15-)
    (/note="CUB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00059-)
    (291..34-)
    1 (/note="TSP-type-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00210-)
    (345..39-)
    2 (/note="TSP-type-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU-)
  • Interpro: IPR000859  IPR032471  IPR017981  IPR008077  IPR036445   IPR001879  IPR000832  IPR017983  IPR000203  IPR000884  IPR036383  
  • Prosite: PS01180 PS00650 PS50227 PS50261 PS50221 PS50092
  • PDB: 4DLO
  • PDBsum: 4DLO
  • DIP: 56121
  • STRING: ENSP00000359630
• Other Databases: GeneCards:  ADGRB3  Malacards:  ADGRB3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0098794	postsynapse	IBA	cellular component
GO:0043083	synaptic cleft	IBA	cellular component
GO:0016322	neuron remodeling	IBA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0007520	myoblast fusion	IDA	biological process
GO:0048814	regulation of dendrite morphogenesis	ISS	biological process
GO:0005886	plasma membrane	IPI	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005096	GTPase activator activity	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016525	negative regulation of angiogenesis	IEA	biological process
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0099558	maintenance of synapse structure	IEA	biological process
GO:0098794	postsynapse	IEA	cellular component
GO:0043083	synaptic cleft	IEA	cellular component
GO:0016322	neuron remodeling	IEA	biological process
GO:0061743	motor learning	IEA	biological process
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0048814	regulation of dendrite morphogenesis	IEA	biological process
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq