• Gene id: 57698

Gene Summary

• Gene Symbol: SHTN1   Gene   UCSC   Ensembl
• Aliases: KIAA1598, shootin-1
• Gene name: shootin 1
• Alternate names: shootin-1, shootin1,
• Gene location: 10q25.3 (117126585: 116881476)     Exons: 21     NC_000010.11
• OMIM: 611171

Protein Summary

• Protein general information: A0MZ66  
  • Name: Shootin 1 (Shootin1)
  • Length: 631  
  • Mass: 71640
• Sequence:

  MNSSDEEKQLQLITSLKEQAIGEYEDLRAENQKTKEKCDKIRQERDEAVKKLEEFQKISHMVIEEVNFMQNHLEI
  EKTCRESAEALATKLNKENKTLKRISMLYMAKLGPDVITEEINIDDEDSTTDTDGAAETCVSVQCQKQIKELRDQ
  IVSVQEEKKILAIELENLKSKLVEVIEEVNKVKQEKTVLNSEVLEQRKVLEKCNRVSMLAVEEYEEMQVNLELEK
  DLRKKAESFAQEMFIEQNKLKRQSHLLLQSSIPDQQLLKALDENAKLTQQLEEERIQHQQKVKELEEQLENETLH
  KEIHNLKQQLELLEEDKKELELKYQNSEEKARNLKHSVDELQKRVNQSENSVPPPPPPPPPLPPPPPNPIRSLMS
  MIRKRSHPSGSGAKKEKATQPETTEEVTDLKRQAVEEMMDRIKKGVHLRPVNQTARPKTKPESSKGCESAVDELK
  GILGTLNKSTSSRSLKSLDPENSETELERILRRRKVTAEADSSSPTGILATSESKSMPVLGSVSSVTKTALNKKT
  LEAEFNSPSPPTPEPGEGPRKLEGCTSSKVTFQPPSSIGCRKKYIDGEKQAEPVVVLDPVSTHEPQTKDQVAEKD
  PTQHKEDEGEIQPENKEDSIENVRETDSSNC

• Structural information:
  • Interpro: IPR024849  
  • STRING: ENSP00000347532
• Other Databases: GeneCards:  SHTN1  Malacards:  SHTN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2001224	positive regulation of neuron migration	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:0030424	axon	ISS	cellular component
GO:0015630	microtubule cytoskeleton	ISS	cellular component
GO:2000114	regulation of establishment of cell polarity	ISS	biological process
GO:0044295	axonal growth cone	ISS	cellular component
GO:0030175	filopodium	ISS	cellular component
GO:0045773	positive regulation of axon extension	ISS	biological process
GO:0043204	perikaryon	ISS	cellular component
GO:0031252	cell leading edge	ISS	cellular component
GO:0030426	growth cone	ISS	cellular component
GO:0005875	microtubule associated complex	ISS	cellular component
GO:0061163	endoplasmic reticulum polarization	ISS	biological process
GO:0048812	neuron projection morphogenesis	ISS	biological process
GO:0030027	lamellipodium	ISS	cellular component
GO:0007409	axonogenesis	ISS	biological process
GO:0051015	actin filament binding	ISS	molecular function
GO:0032488	Cdc42 protein signal transduction	ISS	biological process
GO:0007265	Ras protein signal transduction	ISS	biological process
GO:0061573	actin filament bundle retrograde transport	ISS	biological process
GO:0060327	cytoplasmic actin-based contraction involved in cell motility	ISS	biological process
GO:0038007	netrin-activated signaling pathway	ISS	biological process
GO:0006930	substrate-dependent cell migration, cell extension	ISS	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2001224	positive regulation of neuron migration	IEA	biological process
GO:2001222	regulation of neuron migration	IEA	biological process
GO:0061163	endoplasmic reticulum polarization	IEA	biological process
GO:0048812	neuron projection morphogenesis	IEA	biological process
GO:0043204	perikaryon	IEA	cellular component
GO:0031252	cell leading edge	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0019894	kinesin binding	IEA	molecular function
GO:0005875	microtubule associated complex	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:2000114	regulation of establishment of cell polarity	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0044295	axonal growth cone	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0015630	microtubule cytoskeleton	IEA	cellular component
GO:0045296	cadherin binding	HDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0030175	filopodium	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)