• Gene id: 57689

Gene Summary

• Gene Symbol: LRRC4C   Gene   UCSC   Ensembl
• Aliases: NGL-1, NGL1
• Gene name: leucine rich repeat containing 4C
• Alternate names: leucine-rich repeat-containing protein 4C, netrin-G1 ligand,
• Gene location: 11p12 (41460418: 40107065)     Exons: 14     NC_000011.10
• Gene summary(Entrez): NGL1 is a specific binding partner for netrin G1 (NTNG1; MIM 608818), which is a member of the netrin family of axon guidance molecules (Lin et al., 2003 [PubMed 14595443]).[supplied by OMIM, Mar 2008]
• OMIM: 608817

Protein Summary

• Protein general information: Q9HCJ2  
  • Name: Leucine rich repeat containing protein 4C (Netrin G1 ligand) (NGL 1)
  • Length: 640  
  • Mass: 71,950
• Sequence:

  MLNKMTLHPQQIMIGPRFNRALFDPLLVVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGIS
  TNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKL
  KELWLRNNPIESIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDELD
  LSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHH
  NPWNCNCDILWLSWWIKDMAPSNTACCARCNTPPNLKGRYIGELDQNYFTCYAPVIVEPPADLNVTEGMAAELKC
  RASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASATLNVTAATTTP
  FSYFSTVTVETMEPSQDEARTTDNNVGPTPVVDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMKT
  TKIIIGCFVAITLMAAVMLVIFYKMRKQHHRQNHHAPTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNS
  YKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI

• Structural information:
  • Protein Domains: LRRNT (45-76)
    LRRCT (301-353)
    Ig-like (354-442)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR013098  IPR003599   IPR003598  IPR013106  IPR001611  IPR003591  IPR026906  IPR032675  IPR026878  IPR000372  
  • Prosite: PS50835 PS51450
  • PDB: 3ZYJ
  • PDBsum: 3ZYJ
  • STRING: ENSP00000278198
• Other Databases: GeneCards:  LRRC4C  Malacards:  LRRC4C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004860	protein kinase inhibitor activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0006469	negative regulation of protein kinase activity	IBA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0016021	integral component of membrane	NAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0046426	negative regulation of JAK-STAT cascade	IBA	biological process
GO:0050770	regulation of axonogenesis	IDA	biological process
GO:0004860	protein kinase inhibitor activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006469	negative regulation of protein kinase activity	IBA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	NAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0046426	negative regulation of JAK-STAT cascade	IBA	biological process
GO:0050770	regulation of axonogenesis	IEA	biological process
GO:0050770	regulation of axonogenesis	IDA	biological process
GO:0004860	protein kinase inhibitor activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0006469	negative regulation of protein kinase activity	IBA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0016021	integral component of membrane	NAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0046426	negative regulation of JAK-STAT cascade	IBA	biological process
GO:0050770	regulation of axonogenesis	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules
hsa04360	Axon guidance

Diseases

Associated diseases	References
Azoospermia	MIK: 25439847
Albuminuria	GAD: 17903292
Azoospermia	MIK: 25439847
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25439847	Azoospermia			226 (19 with histologically confirmed meiotic arrest, 110 men with azoospermia in the absence of histologic data, 97 fertile men (controls))	Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)