• Gene id: 57678

Gene Summary

• Gene Symbol: GPAM   Gene   UCSC   Ensembl
• Aliases: GPAT, GPAT1
• Gene name: glycerol-3-phosphate acyltransferase, mitochondrial
• Alternate names: glycerol-3-phosphate acyltransferase 1, mitochondrial, GPAT-1,
• Gene location: 10q25.2 (112216305: 112149864)     Exons: 24     NC_000010.11
• Gene summary(Entrez): This gene encodes a mitochondrial enzyme which prefers saturated fatty acids as its substrate for the synthesis of glycerolipids. This metabolic pathway's first step is catalyzed by the encoded enzyme. Two forms for this enzyme exist, one in the mitochond
• OMIM: 602395

Protein Summary

• Protein general information: Q9HCL2  
  • Name: Glycerol 3 phosphate acyltransferase 1, mitochondrial (GPAT 1) (EC 2.3.1.15)
  • Length: 828  
  • Mass: 93795
• Sequence:

  MDESALTLGTIDVSYLPHSSEYSVGRCKHTSEEWGECGFRPTIFRSATLKWKESLMSRKRPFVGRCCYSCTPQSW
  DKFFNPSIPSLGLRNVIYINETHTRHRGWLARRLSYVLFIQERDVHKGMFATNVTENVLNSSRVQEAIAEVAAEL
  NPDGSAQQQSKAVNKVKKKAKRILQEMVATVSPAMIRLTGWVLLKLFNSFFWNIQIHKGQLEMVKAATETNLPLL
  FLPVHRSHIDYLLLTFILFCHNIKAPYIASGNNLNIPIFSTLIHKLGGFFIRRRLDETPDGRKDVLYRALLHGHI
  VELLRQQQFLEIFLEGTRSRSGKTSCARAGLLSVVVDTLSTNVIPDILIIPVGISYDRIIEGHYNGEQLGKPKKN
  ESLWSVARGVIRMLRKNYGCVRVDFAQPFSLKEYLESQSQKPVSALLSLEQALLPAILPSRPSDAADEGRDTSIN
  ESRNATDESLRRRLIANLAEHILFTASKSCAIMSTHIVACLLLYRHRQGIDLSTLVEDFFVMKEEVLARDFDLGF
  SGNSEDVVMHAIQLLGNCVTITHTSRNDEFFITPSTTVPSVFELNFYSNGVLHVFIMEAIIACSLYAVLNKRGLG
  GPTSTPPNLISQEQLVRKAASLCYLLSNEGTISLPCQTFYQVCHETVGKFIQYGILTVAEHDDQEDISPSLAEQQ
  WDKKLPEPLSWRSDEEDEDSDFGEEQRDCYLKVSQSKEHQQFITFLQRLLGPLLEAYSSAAIFVHNFSGPVPEPE
  YLQKLHKYLITRTERNVAVYAESATYCLVKNAVKMFKDIGVFKETKQKRVSVLELSSTFLPQCNRQKLLEYILSF
  VVL

• Structural information:
  • Interpro: IPR022284  IPR041728  IPR028354  IPR002123  
  • CDD: cd07993
  • STRING: ENSP00000265276
• Other Databases: GeneCards:  GPAM  Malacards:  GPAM

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006072	glycerol-3-phosphate metabolic process	IBA	biological process
GO:0006631	fatty acid metabolic process	IBA	biological process
GO:0008654	phospholipid biosynthetic process	IBA	biological process
GO:0019432	triglyceride biosynthetic process	IBA	biological process
GO:0031966	mitochondrial membrane	IBA	cellular component
GO:0004366	glycerol-3-phosphate O-acyltransferase activity	IBA	molecular function
GO:0004366	glycerol-3-phosphate O-acyltransferase activity	IEA	molecular function
GO:0008374	O-acyltransferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0008654	phospholipid biosynthetic process	IEA	biological process
GO:0044255	cellular lipid metabolic process	IEA	biological process
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0008654	phospholipid biosynthetic process	IEA	biological process
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0102420	sn-1-glycerol-3-phosphate C16:0-DCA-CoA acyl transferase activity	IEA	molecular function
GO:0004366	glycerol-3-phosphate O-acyltransferase activity	IEA	molecular function
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0019432	triglyceride biosynthetic process	TAS	biological process
GO:0006654	phosphatidic acid biosynthetic process	TAS	biological process
GO:0033146	regulation of intracellular estrogen receptor signaling pathway	TAS	biological process
GO:0045540	regulation of cholesterol biosynthetic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0070236	negative regulation of activation-induced cell death of T cells	IEA	biological process
GO:0055091	phospholipid homeostasis	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0050707	regulation of cytokine secretion	IEA	biological process
GO:0040018	positive regulation of multicellular organism growth	IEA	biological process
GO:0009749	response to glucose	IEA	biological process
GO:0004366	glycerol-3-phosphate O-acyltransferase activity	IEA	molecular function
GO:0070970	interleukin-2 secretion	IEA	biological process
GO:0055089	fatty acid homeostasis	IEA	biological process
GO:0042104	positive regulation of activated T cell proliferation	IEA	biological process
GO:0006650	glycerophospholipid metabolic process	IEA	biological process
GO:0006641	triglyceride metabolic process	IEA	biological process
GO:0006637	acyl-CoA metabolic process	IEA	biological process
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0016024	CDP-diacylglycerol biosynthetic process	IEA	biological process
GO:0019432	triglyceride biosynthetic process	IDA	biological process
GO:0004366	glycerol-3-phosphate O-acyltransferase activity	IMP	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00564	Glycerophospholipid metabolism
hsa00561	Glycerolipid metabolism

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)