• Gene id: 57647

Gene Summary

• Gene Symbol: DHX37   Gene   UCSC   Ensembl
• Aliases: DDX37, Dhr1, NEDBAVC, SRXY11
• Gene name: DEAH-box helicase 37
• Alternate names: probable ATP-dependent RNA helicase DHX37, DEAD/DEAH box helicase DDX37, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 37, DEAH (Asp-Glu-Ala-His) box polypeptide 37, DEAH box protein 37,
• Gene location: 12q24.31 (124989130: 124946823)     Exons: 28     NC_000012.12
• Gene summary(Entrez): This gene encodes a DEAD box protein. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as
• OMIM: 603405

Protein Summary

• Protein general information: Q8IY37  
  • Name: Probable ATP dependent RNA helicase DHX37 (EC 3.6.4.13) (DEAH box protein 37)
  • Length: 1157  
  • Mass: 129545
• Sequence:

  MGKLRRRYNIKGRQQAGPGPSKGPPEPPPVQLELEDKDTLKGVDASNALVLPGKKKKKTKAPPLSKKEKKPLTKK
  EKKVLQKILEQKEKKSQRAEMLQKLSEVQASEAEMRLFYTTSKLGTGNRMYHTKEKADEVVAPGQEKISSLSGAH
  RKRRRWPSAEEEEEEEEESESELEEESELDEDPAAEPAEAGVGTTVAPLPPAPAPSSQPVPAGMTVPPPPAAAPP
  LPRALAKPAVFIPVNRSPEMQEERLKLPILSEEQVIMEAVAEHPIVIVCGETGSGKTTQVPQFLYEAGFSSEDSI
  IGVTEPRRVAAVAMSQRVAKEMNLSQRVVSYQIRYEGNVTEETRIKFMTDGVLLKEIQKDFLLLRYKVVIIDEAH
  ERSVYTDILIGLLSRIVTLRAKRNLPLKLLIMSATLRVEDFTQNPRLFAKPPPVIKVESRQFPVTVHFNKRTPLE
  DYSGECFRKVCKIHRMLPAGGILVFLTGQAEVHALCRRLRKAFPPSRARPQEKDDDQKDSVEEMRKFKKSRARAK
  KARAEVLPQINLDHYSVLPAGEGDEDREAEVDEEEGALDSDLDLDLGDGGQDGGEQPDASLPLHVLPLYSLLAPE
  KQAQVFKPPPEGTRLCVVATNVAETSLTIPGIKYVVDCGKVKKRYYDRVTGVSSFRVTWVSQASADQRAGRAGRT
  EPGHCYRLYSSAVFGDFEQFPPPEITRRPVEDLILQMKALNVEKVINFPFPTPPSVEALLAAEELLIALGALQPP
  QKAERVKQLQENRLSCPITALGRTMATFPVAPRYAKMLALSRQHGCLPYAITIVASMTVRELFEELDRPAASDEE
  LTRLKSKRARVAQMKRTWAGQGASLKLGDLMVLLGAVGACEYASCTPQFCEANGLRYKAMMEIRRLRGQLTTAVN
  AVCPEAELFVDPKMQPPTESQVTYLRQIVTAGLGDHLARRVQSEEMLEDKWRNAYKTPLLDDPVFIHPSSVLFKE
  LPEFVVYQEIVETTKMYMKGVSSVEVQWIPALLPSYCQFDKPLEEPAPTYCPERGRVLCHRASVFYRVGWPLPAI
  EVDFPEGIDRYKHFARFLLEGQVFRKLASYRSCLLSSPGTMLKTWARLQPRTESLLRALVAEKADCHEALLAAWK
  KNPKYLLAEYCEWLPQAMHPDIEKAWPPTTVH

• Structural information:
  • Protein Domains: (262..42-)
    (/note="Helicase-ATP-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00541-)
    (459..71-)
    (/note="Helicase-C-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00542"-)
  • Interpro: IPR011545  IPR011709  IPR007502  IPR014001  IPR001650   IPR027417  
  • Prosite: PS51192 PS51194
  • STRING: ENSP00000311135
• Other Databases: GeneCards:  DHX37  Malacards:  DHX37

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IBA	biological process
GO:0005730	nucleolus	IBA	cellular component
GO:0003723	RNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0042254	ribosome biogenesis	IDA	biological process
GO:0005730	nucleolus	IDA	cellular component
GO:2000020	positive regulation of male gonad development	IDA	biological process
GO:0042255	ribosome assembly	IDA	biological process
GO:0034511	U3 snoRNA binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0007420	brain development	IMP	biological process
GO:0004386	helicase activity	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0004386	helicase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0003724	RNA helicase activity	IEA	molecular function
GO:0006364	rRNA processing	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray