• Gene id: 57646

Gene Summary

• Gene Symbol: USP28   Gene   UCSC   Ensembl
• Gene name: ubiquitin specific peptidase 28
• Alternate names: ubiquitin carboxyl-terminal hydrolase 28, deubiquitinating enzyme 28, ubiquitin carboxyl-terminal hydrolase 28 variant 1, ubiquitin thioesterase 28, ubiquitin thiolesterase 28, ubiquitin-specific-processing protease 28,
• Gene location: 11q23.2 (43300953: 43323107)     Exons: 24     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a deubiquitinase involved in the DNA damage pathway and DNA damage-induced apoptosis. Overexpression of this gene is seen in several cancers. [provided by RefSeq, Oct 2016]
• OMIM: 610748

Protein Summary

• Protein general information: Q96RU2  
  • Name: Ubiquitin carboxyl terminal hydrolase 28 (EC 3.4.19.12) (Deubiquitinating enzyme 28) (Ubiquitin thioesterase 28) (Ubiquitin specific processing protease 28)
  • Length: 1077  
  • Mass: 122491
• Sequence:

  MTAELQQDDAAGAADGHGSSCQMLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTDERVKEPSQDTVATEP
  SEVEGSAANKEVLAKVIDLTHDNKDDLQAAIALSLLESPKIQADGRDLNRMHEATSAETKRSKRKRCEVWGENPN
  PNDWRRVDGWPVGLKNVGNTCWFSAVIQSLFQLPEFRRLVLSYSLPQNVLENCRSHTEKRNIMFMQELQYLFALM
  MGSNRKFVDPSAALDLLKGAFRSSEEQQQDVSEFTHKLLDWLEDAFQLAVNVNSPRNKSENPMVQLFYGTFLTEG
  VREGKPFCNNETFGQYPLQVNGYRNLDECLEGAMVEGDVELLPSDHSVKYGQERWFTKLPPVLTFELSRFEFNQS
  LGQPEKIHNKLEFPQIIYMDRYMYRSKELIRNKRECIRKLKEEIKILQQKLERYVKYGSGPARFPLPDMLKYVIE
  FASTKPASESCPPESDTHMTLPLSSVHCSVSDQTSKESTSTESSSQDVESTFSSPEDSLPKSKPLTSSRSSMEMP
  SQPAPRTVTDEEINFVKTCLQRWRSEIEQDIQDLKTCIASTTQTIEQMYCDPLLRQVPYRLHAVLVHEGQANAGH
  YWAYIYNQPRQSWLKYNDISVTESSWEEVERDSYGGLRNVSAYCLMYINDKLPYFNAEAAPTESDQMSEVEALSV
  ELKHYIQEDNWRFEQEVEEWEEEQSCKIPQMESSTNSSSQDYSTSQEPSVASSHGVRCLSSEHAVIVKEQTAQAI
  ANTARAYEKSGVEAALSEVMLSPAMQGVILAIAKARQTFDRDGSEAGLIKAFHEEYSRLYQLAKETPTSHSDPRL
  QHVLVYFFQNEAPKRVVERTLLEQFADKNLSYDERSISIMKVAQAKLKEIGPDDMNMEEYKKWHEDYSLFRKVSV
  YLLTGLELYQKGKYQEALSYLVYAYQSNAALLMKGPRRGVKESVIALYRRKCLLELNAKAASLFETNDDHSVTEG
  INVMNELIIPCIHLIINNDISKDDLDAIEVMRNHWCSYLGQDIAENLQLCLGEFLPRLLDPSAEIIVLKEPPTIR
  PNSPYDLCSRFAAVMESIQGVSTVTVK

• Structural information:
  • Protein Domains: (97..11-)
    (/note="UIM-)
    (/evidence="ECO:0000305-)
    (162..65-)
    (/note="USP"-)
  • Interpro: IPR038765  IPR001394  IPR009060  IPR018200  IPR028889  
  • Prosite: PS00972 PS00973 PS50235
  • PDB: 2LVA 2MUU 6H4H 6H4I 6HEH 6HEI 6HEJ 6HEK
  • PDBsum: 2LVA 2MUU 6H4H 6H4I 6HEH 6HEI 6HEJ 6HEK
  • STRING: ENSP00000003302
• Other Databases: GeneCards:  USP28  Malacards:  USP28

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IBA	molecular function
GO:0000077	DNA damage checkpoint	IBA	biological process
GO:0016579	protein deubiquitination	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0004197	cysteine-type endopeptidase activity	IBA	molecular function
GO:0042771	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IDA	biological process
GO:0005654	nucleoplasm	IDA	cellular component
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IDA	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IDA	molecular function
GO:0016579	protein deubiquitination	IDA	biological process
GO:0016579	protein deubiquitination	IDA	biological process
GO:0016579	protein deubiquitination	IDA	biological process
GO:0010212	response to ionizing radiation	IDA	biological process
GO:0007265	Ras protein signal transduction	IMP	biological process
GO:0000077	DNA damage checkpoint	IMP	biological process
GO:0031647	regulation of protein stability	IMP	biological process
GO:0016579	protein deubiquitination	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008283	cell population proliferation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IMP	molecular function
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IMP	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0016579	protein deubiquitination	IEA	biological process
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0016579	protein deubiquitination	TAS	biological process
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0034644	cellular response to UV	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq