• Gene id: 5764

Gene Summary

• Gene Symbol: PTN   Gene   UCSC   Ensembl
• Aliases: HARP, HB-GAM, HBBM, HBGF-8, HBGF8, HBNF, HBNF-1, NEGF1, OSF-1
• Gene name: pleiotrophin
• Alternate names: pleiotrophin, heparin affin regulatory protein, heparin-binding brain mitogen, heparin-binding growth factor 8, heparin-binding growth-associated molecule, heparin-binding neurite outgrowth promoting factor, heparin-binding neurite outgrowth-promoting factor 1, ,
• Gene location: 7q33 (137343732: 137227340)     Exons: 6     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene is a secreted heparin-binding growth factor. The protein has significant roles in cell growth and survival, cell migration, angiogenesis and tumorigenesis. Alternative splicing and the use of alternative promoters results
• OMIM: 162095

Protein Summary

• Protein general information: P21246  
  • Name: Pleiotrophin (PTN) (Heparin binding brain mitogen) (HBBM) (Heparin binding growth factor 8) (HBGF 8) (Heparin binding growth associated molecule) (HB GAM) (Heparin binding neurite outgrowth promoting factor) (HBNF) (Heparin binding neurite outgrowth promo
  • Length: 168  
  • Mass: 18942
  • Tissue specificity: Osteoblast and brain. {ECO
• Sequence:

  MQAQQYQQQRRKFAAAFLAFIFILAAVDTAEAGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAE
  CKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQ
  AESKKKKKEGKKQEKMLD

• Structural information:
  • Interpro: IPR000762  IPR020090  IPR038130  IPR020091  IPR020089   IPR037122  IPR020092  
  • Prosite: PS00619 PS00620
  • PDB: 2N6F
  • PDBsum: 2N6F
  • DIP: 5953
  • STRING: ENSP00000341170
• Other Databases: GeneCards:  PTN  Malacards:  PTN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008083	growth factor activity	IBA	molecular function
GO:0005576	extracellular region	IBA	cellular component
GO:0035374	chondroitin sulfate binding	IDA	molecular function
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0043932	ossification involved in bone remodeling	IDA	biological process
GO:0004864	protein phosphatase inhibitor activity	IDA	molecular function
GO:0007229	integrin-mediated signaling pathway	IDA	biological process
GO:0008083	growth factor activity	IDA	molecular function
GO:0008201	heparin binding	IDA	molecular function
GO:0043113	receptor clustering	IDA	biological process
GO:0048714	positive regulation of oligodendrocyte differentiation	IDA	biological process
GO:2000347	positive regulation of hepatocyte proliferation	ISS	biological process
GO:0002690	positive regulation of leukocyte chemotaxis	ISS	biological process
GO:0002232	leukocyte chemotaxis involved in inflammatory response	ISS	biological process
GO:0045778	positive regulation of ossification	ISS	biological process
GO:1900006	positive regulation of dendrite development	ISS	biological process
GO:0048680	positive regulation of axon regeneration	ISS	biological process
GO:0031104	dendrite regeneration	ISS	biological process
GO:0007613	memory	ISS	biological process
GO:0030501	positive regulation of bone mineralization	ISS	biological process
GO:0048477	oogenesis	ISS	biological process
GO:0010996	response to auditory stimulus	ISS	biological process
GO:0048167	regulation of synaptic plasticity	ISS	biological process
GO:0042246	tissue regeneration	ISS	biological process
GO:0140059	dendrite arborization	ISS	biological process
GO:0046697	decidualization	ISS	biological process
GO:0010976	positive regulation of neuron projection development	ISS	biological process
GO:0031641	regulation of myelination	ISS	biological process
GO:0007612	learning	ISS	biological process
GO:2000036	regulation of stem cell population maintenance	ISS	biological process
GO:1903706	regulation of hemopoiesis	ISS	biological process
GO:0010594	regulation of endothelial cell migration	ISS	biological process
GO:0044849	estrous cycle	ISS	biological process
GO:2000738	positive regulation of stem cell differentiation	ISS	biological process
GO:0007406	negative regulation of neuroblast proliferation	ISS	biological process
GO:1900272	negative regulation of long-term synaptic potentiation	ISS	biological process
GO:0048714	positive regulation of oligodendrocyte differentiation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005178	integrin binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0051781	positive regulation of cell division	IEA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0008201	heparin binding	IEA	molecular function
GO:0004864	protein phosphatase inhibitor activity	TAS	molecular function
GO:0007185	transmembrane receptor protein tyrosine phosphatase signaling pathway	TAS	biological process
GO:0007399	nervous system development	TAS	biological process
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000347	positive regulation of hepatocyte proliferation	IEA	biological process
GO:1900006	positive regulation of dendrite development	IEA	biological process
GO:0048477	oogenesis	IEA	biological process
GO:0048167	regulation of synaptic plasticity	IEA	biological process
GO:0045597	positive regulation of cell differentiation	IEA	biological process
GO:0030501	positive regulation of bone mineralization	IEA	biological process
GO:0010996	response to auditory stimulus	IEA	biological process
GO:0007613	memory	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0002690	positive regulation of leukocyte chemotaxis	IEA	biological process
GO:0002232	leukocyte chemotaxis involved in inflammatory response	IEA	biological process
GO:0001503	ossification	IEA	biological process
GO:2000347	positive regulation of hepatocyte proliferation	IEA	biological process
GO:1990089	response to nerve growth factor	IEA	biological process
GO:1904399	heparan sulfate binding	IEA	molecular function
GO:1904391	response to ciliary neurotrophic factor	IEA	biological process
GO:1904373	response to kainic acid	IEA	biological process
GO:0098794	postsynapse	IEA	cellular component
GO:0071456	cellular response to hypoxia	IEA	biological process
GO:0071305	cellular response to vitamin D	IEA	biological process
GO:0060291	long-term synaptic potentiation	IEA	biological process
GO:0060041	retina development in camera-type eye	IEA	biological process
GO:0050680	negative regulation of epithelial cell proliferation	IEA	biological process
GO:0048680	positive regulation of axon regeneration	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0045837	negative regulation of membrane potential	IEA	biological process
GO:0045778	positive regulation of ossification	IEA	biological process
GO:0045545	syndecan binding	IEA	molecular function
GO:0038085	vascular endothelial growth factor binding	IEA	molecular function
GO:0036120	cellular response to platelet-derived growth factor stimulus	IEA	biological process
GO:0035373	chondroitin sulfate proteoglycan binding	IEA	molecular function
GO:0032570	response to progesterone	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0031104	dendrite regeneration	IEA	biological process
GO:0030336	negative regulation of cell migration	IEA	biological process
GO:0021794	thalamus development	IEA	biological process
GO:0021549	cerebellum development	IEA	biological process
GO:0021510	spinal cord development	IEA	biological process
GO:0016525	negative regulation of angiogenesis	IEA	biological process
GO:0014823	response to activity	IEA	biological process
GO:0010811	positive regulation of cell-substrate adhesion	IEA	biological process
GO:0008360	regulation of cell shape	IEA	biological process
GO:0005604	basement membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:2000738	positive regulation of stem cell differentiation	IEA	biological process
GO:2000036	regulation of stem cell population maintenance	IEA	biological process
GO:1903706	regulation of hemopoiesis	IEA	biological process
GO:1900272	negative regulation of long-term synaptic potentiation	IEA	biological process
GO:0140059	dendrite arborization	IEA	biological process
GO:0046697	decidualization	IEA	biological process
GO:0044849	estrous cycle	IEA	biological process
GO:0042246	tissue regeneration	IEA	biological process
GO:0031641	regulation of myelination	IEA	biological process
GO:0030282	bone mineralization	IEA	biological process
GO:0007612	learning	IEA	biological process
GO:0007406	negative regulation of neuroblast proliferation	IEA	biological process
GO:1904397	negative regulation of neuromuscular junction development	IEA	biological process
GO:1904395	positive regulation of skeletal muscle acetylcholine-gated channel clustering	IEA	biological process
GO:1904389	rod bipolar cell differentiation	IEA	biological process
GO:0098793	presynapse	IEA	cellular component
GO:0072201	negative regulation of mesenchymal cell proliferation	IEA	biological process
GO:0071407	cellular response to organic cyclic compound	IEA	biological process
GO:0060253	negative regulation of glial cell proliferation	IEA	biological process
GO:0060221	retinal rod cell differentiation	IEA	biological process
GO:0045446	endothelial cell differentiation	IEA	biological process
GO:0044849	estrous cycle	IEA	biological process
GO:0043394	proteoglycan binding	IEA	molecular function
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0034644	cellular response to UV	IEA	biological process
GO:0031594	neuromuscular junction	IEA	cellular component
GO:0030902	hindbrain development	IEA	biological process
GO:0030324	lung development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0008201	heparin binding	IEA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0007612	learning	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0007420	brain development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005539	glycosaminoglycan binding	IEA	molecular function
GO:0001889	liver development	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0019901	protein kinase binding	IPI	molecular function

Diseases

Associated diseases	References
adrenal carcinoma	PMID:1464602
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)