About Us

Search Result


Gene id 57616
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol TSHZ3   Gene   UCSC   Ensembl
Aliases TSH3, ZNF537
Gene name teashirt zinc finger homeobox 3
Alternate names teashirt homolog 3, teashirt family zinc finger 3, zinc finger protein 537,
Gene location 19q12 (31349435: 31149875)     Exons: 7     NC_000019.10
Gene summary(Entrez) This gene encodes a zinc-finger transcription factor that regulates smooth muscle cell differentiation in the developing urinary tract. Consistent with this role, mice in which this gene has been inactivated exhibit abnormal gene expression in urinary tra
OMIM 600027

Protein Summary

Protein general information Q63HK5  

Name: Teashirt homolog 3 (Zinc finger protein 537)

Length: 1081  Mass: 118566

Tissue specificity: Expressed in brain; strongly reduced in post-mortem elderly subjects with Alzheimer disease (PubMed

Sequence MPRRKQQAPRRAAAYVSEELKAAALVDEGLDPEEHTADGEPSAKYMCPEKELARACPSYQNSPAAEFSCHEMDSE
SHISETSDRMADFESGSIKNEEETKEVTVPLEDTTVSDSLEQMKAVYNNFLSNSYWSNLNLNLHQPSSEKNNGSS
SSSSSSSSSCGSGSFDWHQSAMAKTLQQVSQSRMLPEPSLFSTVQLYRQSSKLYGSIFTGASKFRCKDCSAAYDT
LVELTVHMNETGHYRDDNHETDNNNPKRWSKPRKRSLLEMEGKEDAQKVLKCMYCGHSFESLQDLSVHMIKTKHY
QKVPLKEPVTPVAAKIIPATRKKASLELELPSSPDSTGGTPKATISDTNDALQKNSNPYITPNNRYGHQNGASYA
WHFEARKSQILKCMECGSSHDTLQELTAHMMVTGHFIKVTNSAMKKGKPIVETPVTPTITTLLDEKVQSVPLAAT
TFTSPSNTPASISPKLNVEVKKEVDKEKAVTDEKPKQKDKPGEEEEKCDISSKYHYLTENDLEESPKGGLDILKS
LENTVTSAINKAQNGTPSWGGYPSIHAAYQLPNMMKLSLGSSGKSTPLKPMFGNSEIVSPTKNQTLVSPPSSQTS
PMPKTNFHAMEELVKKVTEKVAKVEEKMKEPDGKLSPPKRATPSPCSSEVGEPIKMEASSDGGFRSQENSPSPPR
DGCKDGSPLAEPVENGKELVKPLASSLSGSTAIITDHPPEQPFVNPLSALQSVMNIHLGKAAKPSLPALDPMSML
FKMSNSLAEKAAVATPPPLQSKKADHLDRYFYHVNNDQPIDLTKGKSDKGCSLGSVLLSPTSTAPATSSSTVTTA
KTSAVVSFMSNSPLRENALSDISDMLKNLTESHTSKSSTPSSISEKSDIDGATLEEAEESTPAQKRKGRQSNWNP
QHLLILQAQFAASLRQTSEGKYIMSDLSPQERMHISRFTGLSMTTISHWLANVKYQLRRTGGTKFLKNLDTGHPV
FFCNDCASQIRTPSTYISHLESHLGFRLRDLSKLSTEQINSQIAQTKSPSEKMVTSSPEEDLGTSYQCKLCNRTF
ASKHAVKLHLSKTHGKSPEDHLLYVSELEKQ
Structural information
Interpro:  IPR001356  IPR027008  IPR026810  IPR013087  
Prosite:   PS50071 PS00028 PS50157
CDD:   cd00086

PDB:  
2DMI
PDBsum:   2DMI
MINT:  
STRING:   ENSP00000240587
Other Databases GeneCards:  TSHZ3  Malacards:  TSHZ3

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0000790 nuclear chromatin
ISA cellular component
GO:0000981 DNA-binding transcription
factor activity, RNA pol
ymerase II-specific
ISM molecular function
GO:0000981 DNA-binding transcription
factor activity, RNA pol
ymerase II-specific
ISA molecular function
GO:0005634 nucleus
IBA cellular component
GO:0006357 regulation of transcripti
on by RNA polymerase II
IBA biological process
GO:0003682 chromatin binding
IBA molecular function
GO:0003682 chromatin binding
IDA molecular function
GO:0005634 nucleus
IDA cellular component
GO:0002087 regulation of respiratory
gaseous exchange by nerv
ous system process
ISS biological process
GO:0060291 long-term synaptic potent
iation
ISS biological process
GO:0051968 positive regulation of sy
naptic transmission, glut
amatergic
ISS biological process
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0003682 chromatin binding
IEA molecular function
GO:0045892 negative regulation of tr
anscription, DNA-template
d
IEA biological process
GO:0003677 DNA binding
IEA molecular function
GO:0005634 nucleus
IEA cellular component
GO:0010468 regulation of gene expres
sion
IEA biological process
GO:0042995 cell projection
IEA cellular component
GO:0046872 metal ion binding
IEA molecular function
GO:0003677 DNA binding
IEA molecular function
GO:0007275 multicellular organism de
velopment
IEA biological process
GO:0003677 DNA binding
IEA molecular function
GO:0005634 nucleus
IEA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005634 nucleus
IEA cellular component
GO:0030426 growth cone
IEA cellular component
GO:0005886 plasma membrane
IDA cellular component
GO:0005654 nucleoplasm
IDA cellular component
GO:0045892 negative regulation of tr
anscription, DNA-template
d
IDA biological process
GO:0000790 nuclear chromatin
ISA cellular component
GO:0000981 DNA-binding transcription
factor activity, RNA pol
ymerase II-specific
ISM molecular function
GO:0000981 DNA-binding transcription
factor activity, RNA pol
ymerase II-specific
ISA molecular function
GO:0005634 nucleus
IBA cellular component
GO:0006357 regulation of transcripti
on by RNA polymerase II
IBA biological process
GO:0003682 chromatin binding
IBA molecular function
GO:0003682 chromatin binding
IDA molecular function
GO:0005634 nucleus
IDA cellular component
GO:0002087 regulation of respiratory
gaseous exchange by nerv
ous system process
ISS biological process
GO:0060291 long-term synaptic potent
iation
ISS biological process
GO:0051968 positive regulation of sy
naptic transmission, glut
amatergic
ISS biological process
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0003682 chromatin binding
IEA molecular function
GO:0045892 negative regulation of tr
anscription, DNA-template
d
IEA biological process
GO:0003677 DNA binding
IEA molecular function
GO:0005634 nucleus
IEA cellular component
GO:0010468 regulation of gene expres
sion
IEA biological process
GO:0042995 cell projection
IEA cellular component
GO:0046872 metal ion binding
IEA molecular function
GO:0003677 DNA binding
IEA molecular function
GO:0007275 multicellular organism de
velopment
IEA biological process
GO:0003677 DNA binding
IEA molecular function
GO:0005634 nucleus
IEA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005634 nucleus
IEA cellular component
GO:0030426 growth cone
IEA cellular component
GO:0005886 plasma membrane
IDA cellular component
GO:0005654 nucleoplasm
IDA cellular component
GO:0045892 negative regulation of tr
anscription, DNA-template
d
IDA biological process
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Cryptorchidism MIK: 28606200

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract