• Gene id: 57600

Gene Summary

• Gene Symbol: FNIP2   Gene   UCSC   Ensembl
• Aliases: FNIPL, MAPO1
• Gene name: folliculin interacting protein 2
• Alternate names: folliculin-interacting protein 2, FNIP1-like protein, O6-methylguanine-induced apoptosis 1 protein,
• Gene location: 4q32.1 (158769025: 158908049)     Exons: 22     NC_000004.12
• Gene summary(Entrez): This gene encodes a protein that binds to the tumor suppressor folliculin and to AMP-activated protein kinase (AMPK), and may play a role cellular metabolism and nutrient sensing by regulating the AMPK-mechanistic target of rapamycin signaling pathway. Th
• OMIM: 612768

Protein Summary

• Protein general information: Q9P278  
  • Name: Folliculin interacting protein 2 (FNIP1 like protein) (O6 methylguanine induced apoptosis 1 protein)
  • Length: 1114  
  • Mass: 122115
  • Tissue specificity: Widely expressed with highest levels in muscle, nasal mucosa, salivary gland, uvula, fat, liver, heart, placenta and pancreas (PubMed
• Sequence:

  MAPTLLQKLFNKRGSSGSSAAASAQGRAPKEGPAFSWSCSEFDLNEIRLIVYQDCDRRGRQVLFDSKAVQKIEEV
  TAQKTEDVPIKISAKCCQGSSSVSSSSSSSISSHSSSGGSSHHAKEQLPKYQYTRPASDVNMLGEMMFGSVAMSY
  KGSTLKIHYIRSPPQLMISKVFSARMGSFCGSTNNLQDSFEYINQDPNLGKLNTNQNSLGPCRTGSNLAHSTPVD
  MPSRGQNEDRDSGIARSASLSSLLITPFPSPSSSTSSSSSYQRRWLRSQTTSLENGIIPRRSTDETFSLAEETCS
  SNPAMVRRKKIAISIIFSLCEKEEAQRNFQDFFFSHFPLFESHMNRLKSAIEKAMISCRKIAESSLRVQFYVSRL
  MEALGEFRGTIWNLYSVPRIAEPVWLTMMSGTLEKNQLCQRFLKEFTLLIEQINKNQFFAALLTAVLTYHLAWVP
  TVMPVDHPPIKAFSEKRTSQSVNMLAKTHPYNPLWAQLGDLYGAIGSPVRLTRTVVVGKQKDLVQRILYVLTYFL
  RCSELQENQLTWSGNHGEGDQVLNGSKIITALEKGEVEESEYVVITVRNEPALVPPILPPTAAERHNPWPTGFPE
  CPEGTDSRDLGLKPDKEANRRPEQGSEACSAGCLGPASDASWKPQNAFCGDEKNKEAPQDGSSRLPSCEVLGAGM
  KMDQQAVCELLKVEMPTRLPDRSVAWPCPDRHLREKPSLEKVTFQIGSFASPESDFESRMKKMEERVKACGPSLE
  ASEAADVAQDPQVSRSPFKPGFQENVCCPQNRLSEGDEGESDKGFAEDRGSRNDMAADIAGQLSHAADLGTASHG
  AGGTGGRRLEATRGLYVKAAEGPVLEPVAPRCVQRGPGLVAGANIPCGDDNKKANFRTEGDIPRNESSDSALGDS
  DDEACASAMLDLGHGGDRTGGSLEVELPLPRSQSISTQNVRNFGRSLLAGYCPTYMPDLVLHGTGSDEKLKQCLV
  ADLVHTVHHPVLDEPIAEAVCIIADTDKWSVQVATSQRKVTDNMKLGQDVLVSSQVSSLLQSILQLYKLHLPADF
  CIMHLEDRLQEMYLKSKMLSEYLRGHTRVHVKELGVVLGIESNDLPLLTAIASTHSPYVAQILL

• Structural information:
  • Protein Domains: (42..46-)
    (/note="uDENN-FNIP1/2-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01180-)
    (468..104-)
    (/note="cDENN-FNIP1/2-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01180-)
    (1050..110-)
    (/note="dDENN-FNIP1/2-type)
    (/evidence="E-)
  • Interpro: IPR037545  IPR028086  IPR026156  IPR028085  IPR028084  
  • Prosite: PS51836
  • PDB: 6NZD 6ULG
  • PDBsum: 6NZD 6ULG
  • STRING: ENSP00000264433
• Other Databases: GeneCards:  FNIP2  Malacards:  FNIP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031334	positive regulation of protein-containing complex assembly	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0042030	ATPase inhibitor activity	IBA	molecular function
GO:0051087	chaperone binding	IBA	molecular function
GO:1904262	negative regulation of TORC1 signaling	IBA	biological process
GO:0042030	ATPase inhibitor activity	IDA	molecular function
GO:0051087	chaperone binding	IDA	molecular function
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0001932	regulation of protein phosphorylation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0010823	negative regulation of mitochondrion organization	IEA	biological process
GO:1904262	negative regulation of TORC1 signaling	IEA	biological process
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0034451	centriolar satellite	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0043086	negative regulation of catalytic activity	IEA	biological process
GO:0043086	negative regulation of catalytic activity	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04150	mTOR signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)