• Gene id: 57586

Gene Summary

• Gene Symbol: SYT13   Gene   UCSC   Ensembl
• Gene name: synaptotagmin 13
• Alternate names: synaptotagmin-13, synaptotagmin XIII, sytXIII,
• Gene location: 11p11.2 (45286340: 45240301)     Exons: 8     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the large synaptotagmin protein family. Family members have an extracellular N-terminal transmembrane domain and a cytoplasmic C terminus with two tandem C2 domains (C2A and C2B). Synaptotogmin family members can form homo- a
• OMIM: 607716

Protein Summary

• Protein general information: Q7L8C5  
  • Name: Synaptotagmin 13 (Synaptotagmin XIII) (SytXIII)
  • Length: 426  
  • Mass: 46885
  • Tissue specificity: Expressed in brain, pancreas and kidney. {ECO
• Sequence:

  MVLSVPVIALGATLGTATSILALCGVTCLCRHMHPKKGLLPRDQDPDLEKAKPSLLGSAQQFNVKKSTEPVQPRA
  LLKFPDIYGPRPAVTAPEVINYADYSLRSTEEPTAPASPQPPNDSRLKRQVTEELFILPQNGVVEDVCVMETWNP
  EKAASWNQAPKLHYCLDYDCQKAELFVTRLEAVTSNHDGGCDCYVQGSVANRTGSVEAQTALKKRQLHTTWEEGL
  VLPLAEEELPTATLTLTLRTCDRFSRHSVAGELRLGLDGTSVPLGAAQWGELKTSAKEPSAGAGEVLLSISYLPA
  ANRLLVVLIKAKNLHSNQSKELLGKDVSVKVTLKHQARKLKKKQTKRAKHKINPVWNEMIMFELPDDLLQASSVE
  LEVLGQDDSGQSCALGHCSLGLHTSGSERSHWEEMLKNPRRQIAMWHQLHL

• Structural information:
  • Protein Domains: (158..27-)
    (/note="C2-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041-)
    (287..42-)
    (/note="C2-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041"-)
  • Interpro: IPR000008  IPR035892  IPR028692  
  • Prosite: PS50004
  • PDB: 1WFM
  • PDBsum: 1WFM
  • STRING: ENSP00000020926
• Other Databases: GeneCards:  SYT13  Malacards:  SYT13

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001786	phosphatidylserine binding	IBA	molecular function
GO:0005509	calcium ion binding	IBA	molecular function
GO:0005544	calcium-dependent phospholipid binding	IBA	molecular function
GO:0006906	vesicle fusion	IBA	biological process
GO:0014059	regulation of dopamine secretion	IBA	biological process
GO:0016192	vesicle-mediated transport	IBA	biological process
GO:0017156	calcium-ion regulated exocytosis	IBA	biological process
GO:0017158	regulation of calcium ion-dependent exocytosis	IBA	biological process
GO:0030424	axon	IBA	cellular component
GO:0043005	neuron projection	IBA	cellular component
GO:0071277	cellular response to calcium ion	IBA	biological process
GO:0000149	SNARE binding	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0030276	clathrin binding	IBA	molecular function
GO:0045202	synapse	IBA	cellular component
GO:0070382	exocytic vesicle	IBA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030133	transport vesicle	IDA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)