• Gene id: 57580

Gene Summary

• Gene Symbol: PREX1   Gene   UCSC   Ensembl
• Aliases: P-REX1
• Gene name: phosphatidylinositol-3,4,5-trisphosphate dependent Rac exchange factor 1
• Alternate names: phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein, PIP3 dependent Rac exchange factor 1, ptdIns(3,4,5)-dependent Rac exchanger 1,
• Gene location: 20q13.13 (48827998: 48624251)     Exons: 40     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene acts as a guanine nucleotide exchange factor for the RHO family of small GTP-binding proteins (RACs). It has been shown to bind to and activate RAC1 by exchanging bound GDP for free GTP. The encoded protein, which is foun

Protein Summary

• Protein general information: Q8TCU6  
  • Name: Phosphatidylinositol 3,4,5 trisphosphate dependent Rac exchanger 1 protein (P Rex1) (PtdIns(3,4,5) dependent Rac exchanger 1)
  • Length: 1659  
  • Mass: 186203
  • Tissue specificity: Mainly expressed in peripheral blood leukocytes and brain. Expressed at intermediate level in spleen and lymph nodes, and weakly expressed in other tissues.
• Sequence:

  MEAPSGSEPGGDGAGDCAHPDPRAPGAAAPSSGPGPCAAARESERQLRLRLCVLNEILGTERDYVGTLRFLQSAF
  LHRIRQNVADSVEKGLTEENVKVLFSNIEDILEVHKDFLAALEYCLHPEPQSQHELGNVFLKFKDKFCVYEEYCS
  NHEKALRLLVELNKIPTVRAFLLSCMLLGGRKTTDIPLEGYLLSPIQRICKYPLLLKELAKRTPGKHPDHPAVQS
  ALQAMKTVCSNINETKRQMEKLEALEQLQSHIEGWEGSNLTDICTQLLLQGTLLKISAGNIQERAFFLFDNLLVY
  CKRKSRVTGSKKSTKRTKSINGSLYIFRGRINTEVMEVENVEDGTADYHSNGYTVTNGWKIHNTAKNKWFVCMAK
  TAEEKQKWLDAIIREREQRESLKLGMERDAYVMIAEKGEKLYHMMMNKKVNLIKDRRRKLSTVPKCFLGNEFVAW
  LLEIGEISKTEEGVNLGQALLENGIIHHVSDKHQFKNEQVMYRFRYDDGTYKARSELEDIMSKGVRLYCRLHSLY
  TPVIKDRDYHLKTYKSVLPGSKLVDWLLAQGDCQTREEAVALGVGLCNNGFMHHVLEKSEFRDESQYFRFHADEE
  MEGTSSKNKQLRNDFKLVENILAKRLLILPQEEDYGFDIEEKNKAVVVKSVQRGSLAEVAGLQVGRKIYSINEDL
  VFLRPFSEVESILNQSFCSRRPLRLLVATKAKEIIKIPDQPDTLCFQIRGAAPPYVYAVGRGSEAMAAGLCAGQC
  ILKVNGSNVMNDGAPEVLEHFQAFRSRREEALGLYQWIYHTHEDAQEARASQEASTEDPSGEQAQEEDQADSAFP
  LLSLGPRLSLCEDSPMVTLTVDNVHLEHGVVYEYVSTAGVRCHVLEKIVEPRGCFGLTAKILEAFAANDSVFVEN
  CRRLMALSSAIVTMPHFEFRNICDTKLESIGQRIACYQEFAAQLKSRVSPPFKQAPLEPHPLCGLDFCPTNCHIN
  LMEVSYPKTTPSVGRSFSIRFGRKPSLIGLDPEQGHLNPMSYTQHCITTMAAPSWKCLPAAEGDPQGQGLHDGSF
  GPASGTLGQEDRGLSFLLKQEDREIQDAYLQLFTKLDVALKEMKQYVTQINRLLSTITEPTSGGSCDASLAEEAS
  SLPLVSEESEMDRSDHGGIKKVCFKVAEEDQEDSGHDTMSYRDSYSECNSNRDSVLSYTSVRSNSSYLGSDEMGS
  GDELPCDMRIPSDKQDKLHGCLEHLFNQVDSINALLKGPVMSRAFEETKHFPMNHSLQEFKQKEECTIRGRSLIQ
  ISIQEDPWNLPNSIKTLVDNIQRYVEDGKNQLLLALLKCTDTELQLRRDAIFCQALVAAVCTFSKQLLAALGYRY
  NNNGEYEESSRDASRKWLEQVAATGVLLHCQSLLSPATVKEERTMLEDIWVTLSELDNVTFSFKQLDENYVANTN
  VFYHIEGSRQALKVIFYLDSYHFSKLPSRLEGGASLRLHTALFTKVLENVEGLPSPGSQAAEDLQQDINAQSLEK
  VQQYYRKLRAFYLERSNLPTDASTTAVKIDQLIRPINALDELCRLMKSFVHPKPGAAGSVGAGLIPISSELCYRL
  GACQMVMCGTGMQRSTLSVSLEQAAILARSHGLLPKCIMQATDIMRKQGPRVEILAKNLRVKDQMPQGAPRLYRL
  CQPPVDGDL

• Structural information:
  • Protein Domains: (49..24-)
    (/note="DH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00062-)
    (271..39-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145-)
    (421..49-)
    (/note="DEP-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00066-)
    (523-)
  • Interpro: IPR035899  IPR000591  IPR000219  IPR001331  IPR001478   IPR036034  IPR011993  IPR001849  IPR036388  IPR036390  
  • Prosite: PS50186 PS00741 PS50010 PS50106 PS50003
  • CDD: cd00160
  • PDB: 3QIK 4YON 5D27 5D3V 5D3W 5D3X 5D3Y 5FI0 5FI1
  • PDBsum: 3QIK 4YON 5D27 5D3V 5D3W 5D3X 5D3Y 5FI0 5FI1
  • DIP: 46975
  • STRING: ENSP00000361009
• Other Databases: GeneCards:  PREX1  Malacards:  PREX1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030676	Rac guanyl-nucleotide exchange factor activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0043065	positive regulation of apoptotic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0051056	regulation of small GTPase mediated signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1900026	positive regulation of substrate adhesion-dependent cell spreading	IEA	biological process
GO:0030593	neutrophil chemotaxis	IEA	biological process
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0050773	regulation of dendrite development	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0072593	reactive oxygen species metabolic process	IEA	biological process
GO:0045785	positive regulation of cell adhesion	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0030217	T cell differentiation	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0030426	growth cone	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0043198	dendritic shaft	IEA	cellular component
GO:0030833	regulation of actin filament polymerization	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005543	phospholipid binding	IDA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005089	Rho guanyl-nucleotide exchange factor activity	TAS	molecular function
GO:0006801	superoxide metabolic process	TAS	biological process
GO:0019899	enzyme binding	TAS	molecular function
GO:0005096	GTPase activator activity	TAS	molecular function
GO:0042119	neutrophil activation	TAS	biological process
GO:0030041	actin filament polymerization	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04062	Chemokine signaling pathway
hsa05167	Kaposi sarcoma-associated herpesvirus infection

Diseases

Associated diseases	References
Prostate cancer	PMID:19305425
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq