• Gene id: 57576

Gene Summary

• Gene Symbol: KIF17   Gene   UCSC   Ensembl
• Aliases: KIF17B, KIF3X, KLP-2, OSM-3
• Gene name: kinesin family member 17
• Alternate names: kinesin-like protein KIF17, KIF17 variant protein, KIF3-related motor protein,
• Gene location: 1p36.12 (20718006: 20664013)     Exons: 15     NC_000001.11
• OMIM: 605037

SNPs

rs631357

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000001.11   g.20666326G>A
NC_000001.11   g.20666326G>C
NC_000001.10   g.20992819G>A
NC_000001.10   g.20992819G>C
NG_032064.1   g.219C>T
NG_032064.1   g.219C>G
NM_020816.3   c.2799C>T
NM_020816.3   c.2799C>G
NM_020816.4   c.2799C>T
NM_020816.4   c.2799C>G
NM_020816.2  

Protein Summary

• Protein general information: Q9P2E2  
  • Name: Kinesin like protein KIF17 (KIF3 related motor protein)
  • Length: 1029  
  • Mass: 115068
• Sequence:

  MASEAVKVVVRCRPMNQRERELRCQPVVTVDCARAQCCIQNPGAADEPPKQFTFDGAYHVDHVTEQIYNEIAYPL
  VEGVTEGYNGTIFAYGQTGSGKSFTMQGLPDPPSQRGIIPRAFEHVFESVQCAENTKFLVRASYLEIYNEDVRDL
  LGADTKQKLELKEHPEKGVYVKGLSMHTVHSVAQCEHIMETGWKNRSVGYTLMNKDSSRSHSIFTISIEMSAVDE
  RGKDHLRAGKLNLVDLAGSERQSKTGATGERLKEATKINLSLSALGNVISALVDGRCKHVPYRDSKLTRLLQDSL
  GGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIRNKPRINEDPKDALLREYQEEIKKLKAILTQQMSPSSLSA
  LLSRQVPPDPVQVEEKLLPQPVIQHDVEAEKQLIREEYEERLARLKADYKAEQESRARLEEDITAMRNSYDVRLS
  TLEENLRKETEAVLQVGVLYKAEVMSRAEFASSAEYPPAFQYETVVKPKVFSTTDTLPSDDVSKTQVSSRFAELP
  KVEPSKSEISLGSSESSSLEETSVSEAFPGPEEPSNVEVSMPTEESRSRYFLDECLGQEAAGHLLGEQNYLPQEE
  PQEVPLQGLLGLQDPFAEVEAKLARLSSTVARTDAPQADVPKVPVQVPAPTDLLEPSDARPEAEAADDFPPRPEV
  DLASEVALEVVRTAEPGVWLEAQAPVALVAQPEPLPATAGVKRESVGMEVAVLTDDPLPVVDQQQVLARLQLLEQ
  QVVGGEQAKNKDLKEKHKRRKRYADERRKQLVAALQNSDEDSGDWVLLNVYDSIQEEVRAKSKLLEKMQRKLRAA
  EVEIKDLQSEFQLEKIDYLATIRRQERDSMLLQQLLEQVQPLIRRDCNYSNLEKILRESCWDEDNGFWKIPHPVI
  TKTSLPVAVSTGPQNKPARKTSAADNGEPNMEDDRYRLMLSRSNSENIASNYFRSKRASQILSTDARKSLTHHNS
  PPGLSCPLSNNSAIPPTQAPEMPQPRPFRLESLDIPFTKAKRKKSKSNFGSEPL

• Structural information:
  • Protein Domains: (5..33-)
    (/note="Kinesin-motor)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00283"-)
  • Interpro: IPR027640  IPR019821  IPR001752  IPR036961  IPR027417  
  • Prosite: PS00411 PS50067
  • STRING: ENSP00000247986
• Other Databases: GeneCards:  KIF17  Malacards:  KIF17

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0098971	anterograde dendritic transport of neurotransmitter receptor complex	IBA	biological process
GO:0043005	neuron projection	IBA	cellular component
GO:0030030	cell projection organization	IBA	biological process
GO:0008017	microtubule binding	IBA	molecular function
GO:0007018	microtubule-based movement	IBA	biological process
GO:0005871	kinesin complex	IBA	cellular component
GO:0003777	microtubule motor activity	IBA	molecular function
GO:0016887	ATPase activity	IBA	molecular function
GO:0008574	ATP-dependent microtubule motor activity, plus-end-directed	IBA	molecular function
GO:0005929	cilium	IBA	cellular component
GO:0005874	microtubule	IBA	cellular component
GO:0005815	microtubule organizing center	IBA	cellular component
GO:0005929	cilium	ISS	cellular component
GO:0003777	microtubule motor activity	IEA	molecular function
GO:0007018	microtubule-based movement	IEA	biological process
GO:0008017	microtubule binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005929	cilium	TAS	cellular component
GO:0035735	intraciliary transport involved in cilium assembly	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0003777	microtubule motor activity	IEA	molecular function
GO:0005871	kinesin complex	IEA	cellular component
GO:0005930	axoneme	IEA	cellular component
GO:0007017	microtubule-based process	IEA	biological process
GO:0015630	microtubule cytoskeleton	IEA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0031503	protein-containing complex localization	IEA	biological process
GO:0036064	ciliary basal body	IEA	cellular component
GO:0098971	anterograde dendritic transport of neurotransmitter receptor complex	IEA	biological process
GO:0005929	cilium	IEA	cellular component
GO:0030992	intraciliary transport particle B	IEA	cellular component
GO:0032391	photoreceptor connecting cilium	IEA	cellular component
GO:1990075	periciliary membrane compartment	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0032839	dendrite cytoplasm	IEA	cellular component
GO:0032839	dendrite cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Oligozoospermia or azoospermia	MIK: 20378615
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
20378615	Oligozoospermia or azoospermia	rs631357	Europea n	442 (158 normospermic controls, 63 moderately oligozoospermic samples, 141 severe oligozoospermic samples and 80 non-obstructed azoospermic samples)	Male infertility	GWAS
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq