• Gene id: 57574

Gene Summary

• Gene Symbol: MARCHF4   Gene   UCSC   Ensembl
• Aliases: MARCH-IV, MARCH4, RNF174
• Gene name: membrane associated ring-CH-type finger 4
• Alternate names: E3 ubiquitin-protein ligase MARCHF4, E3 ubiquitin-protein ligase MARCH4, RING finger protein 174, RING-type E3 ubiquitin transferase MARCH4, RING-type E3 ubiquitin transferase MARCHF4, membrane associated ring finger 4, membrane-associated RING finger protein 4,
• Gene location: 2q35 (216372482: 216257864)     Exons: 4     NC_000002.12
• Gene summary(Entrez): MARCH4 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. M
• OMIM: 614031

Protein Summary

• Protein general information: Q9P2E8  
  • Name: E3 ubiquitin protein ligase MARCHF4 (EC 2.3.2.27) (Membrane associated RING finger protein 4) (Membrane associated RING CH protein IV) (MARCH IV) (RING finger protein 174) (RING type E3 ubiquitin transferase MARCHF4)
  • Length: 410  
  • Mass: 45528
  • Tissue specificity: Expressed in brain and placenta. {ECO
• Sequence:

  MLMPLCGLLWWWWCCCSGWYCYGLCAPAPQMLRHQGLLKCRCRMLFNDLKVFLLRRPPQAPLPMHGDPQPPGLAA
  NNTLPALGAGGWAGWRGPREVVGREPPPVPPPPPLPPSSVEDDWGGPATEPPASLLSSASSDDFCKEKTEDRYSL
  GSSLDSGMRTPLCRICFQGPEQGELLSPCRCDGSVKCTHQPCLIKWISERGCWSCELCYYKYHVIAISTKNPLQW
  QAISLTVIEKVQVAAAILGSLFLIASISWLIWSTFSPSARWQRQDLLFQICYGMYGFMDVVCIGLIIHEGPSVYR
  IFKRWQAVNQQWKVLNYDKTKDLEDQKAGGRTNPRTSSSTQANIPSSEEETAGTPAPEQGPAQAAGHPSGPLSHH
  HCAYTILHILSHLRPHEQRSPPGSSRELVMRVTTV

• Structural information:
  • Interpro: IPR011016  IPR013083  
  • Prosite: PS51292
  • STRING: ENSP00000273067
• Other Databases: GeneCards:  MARCHF4  Malacards:  MARCHF4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008270	zinc ion binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0005795	Golgi stack	IDA	cellular component
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R