• Gene id: 57570

Gene Summary

• Gene Symbol: TRMT5   Gene   UCSC   Ensembl
• Aliases: COXPD26, KIAA1393, TRM5
• Gene name: tRNA methyltransferase 5
• Alternate names: tRNA (guanine(37)-N1)-methyltransferase, M1G-methyltransferase, TRM5 tRNA methyltransferase 5 homolog, tRNA (guanine-N(1)-)-methyltransferase, tRNA [GM37] methyltransferase, tRNA-N1G37 methyltransferase,
• Gene location: 14q23.1 (60981689: 60971440)     Exons: 5     NC_000014.9
• Gene summary(Entrez): tRNAs contain as many as 13 or 14 nucleotides that are modified posttranscriptionally by enzymes that are highly specific for particular nucleotides in the tRNA structure. TRMT5 methylates the N1 position of guanosine-37 (G37) in selected tRNAs using S-ad
• OMIM: 611023

Protein Summary

• Protein general information: Q32P41  
  • Name: tRNA (guanine(37) N1) methyltransferase (EC 2.1.1.228) (M1G methyltransferase) (tRNA [GM37] methyltransferase) (tRNA methyltransferase 5 homolog)
  • Length: 509  
  • Mass: 58246
• Sequence:

  MVLWILWRPFGFSGRFLKLESHSITESKSLIPVAWTSLTQMLLEAPGIFLLGQRKRFSTMPETETHERETELFSP
  PSDVRGMTKLDRTAFKKTVNIPVLKVRKEIVSKLMRSLKRAALQRPGIRRVIEDPEDKESRLIMLDPYKIFTHDS
  FEKAELSVLEQLNVSPQISKYNLELTYEHFKSEEILRAVLPEGQDVTSGFSRIGHIAHLNLRDHQLSFKHLIGQV
  MIDKNPGITSAVNKINNIDNMYRNFQMEVLSGEQNMMTKVRENNYTYEFDFSKVYWNPRLSTEHSRITELLKPGD
  VLFDVFAGVGPFAIPVAKKNCTVFANDLNPESHKWLLYNCKLNKVDQKVKVFNLDGKDFLQGPVKEELMQLLGLS
  KERKPSVHVVMNLPAKAIEFLSAFKWLLDGQPCSSEFLPIVHCYSFSKDANPAEDVRQRAGAVLGISLEACSSVH
  LVRNVAPNKEMLCITFQIPASVLYKNQTRNPENHEDPPLKRQRTAEAFSDEKTQIVSNT

• Structural information:
  • Interpro: IPR030382  IPR029063  IPR025792  
  • Prosite: PS51684
  • STRING: ENSP00000261249
• Other Databases: GeneCards:  TRMT5  Malacards:  TRMT5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0005759	mitochondrial matrix	IBA	cellular component
GO:0008175	tRNA methyltransferase activity	IBA	molecular function
GO:0070901	mitochondrial tRNA methylation	IBA	biological process
GO:0002939	tRNA N1-guanine methylation	IBA	biological process
GO:0009019	tRNA (guanine-N1-)-methyltransferase activity	IBA	molecular function
GO:0030488	tRNA methylation	IBA	biological process
GO:0005759	mitochondrial matrix	IDA	cellular component
GO:0070901	mitochondrial tRNA methylation	IMP	biological process
GO:0009019	tRNA (guanine-N1-)-methyltransferase activity	IEA	molecular function
GO:0030488	tRNA methylation	IEA	biological process
GO:0032259	methylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0008033	tRNA processing	IEA	biological process
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0052906	tRNA (guanine(37)-N(1))-methyltransferase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0030488	tRNA methylation	IEA	biological process
GO:0009019	tRNA (guanine-N1-)-methyltransferase activity	IEA	molecular function
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Combined oxidative phosphorylation deficiency	KEGG:H00891
Combined oxidative phosphorylation deficiency	KEGG:H00891
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R