• Gene id: 57555

Gene Summary

• Gene Symbol: NLGN2   Gene   UCSC   Ensembl
• Gene name: neuroligin 2
• Alternate names: neuroligin-2,
• Gene location: 17p13.1 (7405491: 7419859)     Exons: 8     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. [provided b
• OMIM: 606479

Protein Summary

• Protein general information: Q8NFZ4  
  • Name: Neuroligin 2
  • Length: 835  
  • Mass: 90820
  • Tissue specificity: Expressed in the blood vessel walls. Detected in colon, brain and pancreas islets of Langerhans (at protein level). Detected in brain, and at lower levels in pancreas islet beta cells. {ECO
• Sequence:

  MWLLALCLVGLAGAQRGGGGPGGGAPGGPGLGLGSLGEERFPVVNTAYGRVRGVRRELNNEILGPVVQFLGVPYA
  TPPLGARRFQPPEAPASWPGVRNATTLPPACPQNLHGALPAIMLPVWFTDNLEAAATYVQNQSEDCLYLNLYVPT
  EDGPLTKKRDEATLNPPDTDIRDPGKKPVMLFLHGGSYMEGTGNMFDGSVLAAYGNVIVATLNYRLGVLGFLSTG
  DQAAKGNYGLLDQIQALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQKAIAQSGTAISSWSV
  NYQPLKYTRLLAAKVGCDREDSAEAVECLRRKPSRELVDQDVQPARYHIAFGPVVDGDVVPDDPEILMQQGEFLN
  YDMLIGVNQGEGLKFVEDSAESEDGVSASAFDFTVSNFVDNLYGYPEGKDVLRETIKFMYTDWADRDNGEMRRKT
  LLALFTDHQWVAPAVATAKLHADYQSPVYFYTFYHHCQAEGRPEWADAAHGDELPYVFGVPMVGATDLFPCNFSK
  NDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVVWSKFNSKEKQYLHIGLKPRVRDNYRANKVAF
  WLELVPHLHNLHTELFTTTTRLPPYATRWPPRPPAGAPGTRRPPPPATLPPEPEPEPGPRAYDRFPGDSRDYSTE
  LSVTVAVGASLLFLNILAFAALYYKRDRRQELRCRRLSPPGGSGSGVPGGGPLLPAAGRELPPEEELVSLQLKRG
  GGVGADPAEALRPACPPDYTLALRRAPDDVPLLAPGALTLLPSGLGPPPPPPPPSLHPFGPFPPPPPTATSHNNT
  LPHPHSTTRV

• Structural information:
  • Interpro: IPR029058  IPR002018  IPR019819  IPR000460  IPR030023  
  • Prosite: PS00941
  • PDB: 5XEQ
  • PDBsum: 5XEQ
  • STRING: ENSP00000305288
• Other Databases: GeneCards:  NLGN2  Malacards:  NLGN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0099054	presynapse assembly	TAS	biological process
GO:0098983	symmetric, GABA-ergic, inhibitory synapse	TAS	cellular component
GO:0089717	spanning component of membrane	TAS	cellular component
GO:0035418	protein localization to synapse	ISS	biological process
GO:0032024	positive regulation of insulin secretion	IMP	biological process
GO:0007158	neuron cell-cell adhesion	IBA	biological process
GO:0007268	chemical synaptic transmission	IBA	biological process
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0009986	cell surface	IBA	cellular component
GO:0042043	neurexin family protein binding	IBA	molecular function
GO:0045202	synapse	IBA	cellular component
GO:0048488	synaptic vesicle endocytosis	IBA	biological process
GO:0050804	modulation of chemical synaptic transmission	IBA	biological process
GO:0097104	postsynaptic membrane assembly	IBA	biological process
GO:0097105	presynaptic membrane assembly	IBA	biological process
GO:0050808	synapse organization	IEA	biological process
GO:0060077	inhibitory synapse	IEA	cellular component
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0042043	neurexin family protein binding	IEA	molecular function
GO:0050804	modulation of chemical synaptic transmission	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:1902474	positive regulation of protein localization to synapse	IDA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:2000809	positive regulation of synaptic vesicle clustering	IEA	biological process
GO:2000463	positive regulation of excitatory postsynaptic potential	IEA	biological process
GO:1904862	inhibitory synapse assembly	IEA	biological process
GO:0098691	dopaminergic synapse	IEA	cellular component
GO:0097151	positive regulation of inhibitory postsynaptic potential	IEA	biological process
GO:0097119	postsynaptic density protein 95 clustering	IEA	biological process
GO:0051968	positive regulation of synaptic transmission, glutamatergic	IEA	biological process
GO:0050885	neuromuscular process controlling balance	IEA	biological process
GO:0035641	locomotory exploration behavior	IEA	biological process
GO:0002087	regulation of respiratory gaseous exchange by nervous system process	IEA	biological process
GO:2000311	regulation of AMPA receptor activity	IEA	biological process
GO:0099060	integral component of postsynaptic specialization membrane	IEA	cellular component
GO:0098982	GABA-ergic synapse	IEA	cellular component
GO:0098698	postsynaptic specialization assembly	IEA	biological process
GO:0098690	glycinergic synapse	IEA	cellular component
GO:0097116	gephyrin clustering involved in postsynaptic density assembly	IEA	biological process
GO:0097105	presynaptic membrane assembly	IEA	biological process
GO:0097104	postsynaptic membrane assembly	IEA	biological process
GO:0050839	cell adhesion molecule binding	IEA	molecular function
GO:0050804	modulation of chemical synaptic transmission	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0042802	identical protein binding	IEA	molecular function
GO:0042043	neurexin family protein binding	IEA	molecular function
GO:0035418	protein localization to synapse	IEA	biological process
GO:0032230	positive regulation of synaptic transmission, GABAergic	IEA	biological process
GO:0019233	sensory perception of pain	IEA	biological process
GO:0042043	neurexin family protein binding	ISS	molecular function
GO:0050839	cell adhesion molecule binding	ISS	molecular function
GO:0002087	regulation of respiratory gaseous exchange by nervous system process	ISS	biological process
GO:0099055	integral component of postsynaptic membrane	ISS	cellular component
GO:0007158	neuron cell-cell adhesion	ISS	biological process
GO:0050808	synapse organization	ISS	biological process
GO:0051968	positive regulation of synaptic transmission, glutamatergic	ISS	biological process
GO:0060077	inhibitory synapse	ISS	cellular component
GO:0097119	postsynaptic density protein 95 clustering	ISS	biological process
GO:0097151	positive regulation of inhibitory postsynaptic potential	ISS	biological process
GO:0097151	positive regulation of inhibitory postsynaptic potential	ISS	biological process
GO:2000463	positive regulation of excitatory postsynaptic potential	ISS	biological process
GO:0007416	synapse assembly	ISS	biological process
GO:0009986	cell surface	ISS	cellular component
GO:0032230	positive regulation of synaptic transmission, GABAergic	ISS	biological process
GO:0035418	protein localization to synapse	ISS	biological process
GO:0045202	synapse	ISS	cellular component
GO:0050804	modulation of chemical synaptic transmission	ISS	biological process
GO:0051965	positive regulation of synapse assembly	ISS	biological process
GO:0072553	terminal button organization	ISS	biological process
GO:0097104	postsynaptic membrane assembly	ISS	biological process
GO:0097105	presynaptic membrane assembly	ISS	biological process
GO:0097105	presynaptic membrane assembly	ISS	biological process
GO:0097116	gephyrin clustering involved in postsynaptic density assembly	ISS	biological process
GO:2000311	regulation of AMPA receptor activity	ISS	biological process
GO:0042734	presynaptic membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0045217	cell-cell junction maintenance	NAS	biological process
GO:0098609	cell-cell adhesion	NAS	biological process
GO:0045211	postsynaptic membrane	NAS	cellular component
GO:0042043	neurexin family protein binding	NAS	molecular function
GO:0016020	membrane	NAS	cellular component
GO:0007416	synapse assembly	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq