• Gene id: 5754

Gene Summary

• Gene Symbol: PTK7   Gene   UCSC   Ensembl
• Aliases: CCK-4, CCK4
• Gene name: protein tyrosine kinase 7 (inactive)
• Alternate names: inactive tyrosine-protein kinase 7, PTK7 protein tyrosine kinase 7, colon carcinoma kinase 4, pseudo tyrosine kinase receptor 7, tyrosine-protein kinase-like 7,
• Gene location: 6p21.1 (43076313: 43161719)     Exons: 21     NC_000006.12
• Gene summary(Entrez): This gene encodes a member of the receptor protein tyrosine kinase family of proteins that transduce extracellular signals across the cell membrane. The encoded protein lacks detectable catalytic tyrosine kinase activity, is involved in the Wnt signaling
• OMIM: 601890

Protein Summary

• Protein general information: Q13308  
  • Name: Inactive tyrosine protein kinase 7 (Colon carcinoma kinase 4) (CCK 4) (Protein tyrosine kinase 7) (Pseudo tyrosine kinase receptor 7) (Tyrosine protein kinase like 7)
  • Length: 1070  
  • Mass: 118392
  • Tissue specificity: Highly expressed in lung, liver, pancreas, kidney, placenta and melanocytes. Weakly expressed in thyroid gland, ovary, brain, heart and skeletal muscle. Also expressed in erythroleukemia cells. But not expressed in colon.
• Sequence:

  MGAARGSPARPRRLPLLSVLLLPLLGGTQTAIVFIKQPSSQDALQGRRALLRCEVEAPGPVHVYWLLDGAPVQDT
  ERRFAQGSSLSFAAVDRLQDSGTFQCVARDDVTGEEARSANASFNIKWIEAGPVVLKHPASEAEIQPQTQVTLRC
  HIDGHPRPTYQWFRDGTPLSDGQSNHTVSSKERNLTLRPAGPEHSGLYSCCAHSAFGQACSSQNFTLSIADESFA
  RVVLAPQDVVVARYEEAMFHCQFSAQPPPSLQWLFEDETPITNRSRPPHLRRATVFANGSLLLTQVRPRNAGIYR
  CIGQGQRGPPIILEATLHLAEIEDMPLFEPRVFTAGSEERVTCLPPKGLPEPSVWWEHAGVRLPTHGRVYQKGHE
  LVLANIAESDAGVYTCHAANLAGQRRQDVNITVATVPSWLKKPQDSQLEEGKPGYLDCLTQATPKPTVVWYRNQM
  LISEDSRFEVFKNGTLRINSVEVYDGTWYRCMSSTPAGSIEAQARVQVLEKLKFTPPPQPQQCMEFDKEATVPCS
  ATGREKPTIKWERADGSSLPEWVTDNAGTLHFARVTRDDAGNYTCIASNGPQGQIRAHVQLTVAVFITFKVEPER
  TTVYQGHTALLQCEAQGDPKPLIQWKGKDRILDPTKLGPRMHIFQNGSLVIHDVAPEDSGRYTCIAGNSCNIKHT
  EAPLYVVDKPVPEESEGPGSPPPYKMIQTIGLSVGAAVAYIIAVLGLMFYCKKRCKAKRLQKQPEGEEPEMECLN
  GGPLQNGQPSAEIQEEVALTSLGSGPAATNKRHSTSDKMHFPRSSLQPITTLGKSEFGEVFLAKAQGLEEGVAET
  LVLVKSLQSKDEQQQLDFRRELEMFGKLNHANVVRLLGLCREAEPHYMVLEYVDLGDLKQFLRISKSKDEKLKSQ
  PLSTKQKVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSP
  EAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQAGKARLPQPEGCPSKLYRLMQRCWALSPKD
  RPSFSEIASALGDSTVDSKP

• Structural information:
  • Protein Domains: (31..12-)
    1 (/note="Ig-like-C2-type)
    (128..21-)
    2 (/note="Ig-like-C2-type)
    (225..31-)
    3 (/note="Ig-like-C2-type)
    (309..40-)
    4 (/note="Ig-like-C2-type)
    (412..49-)
    5 (/note="Ig-like-C2-type)
    (503..58-)
    (/note="Ig-lik-)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR013098  IPR003599   IPR003598  IPR011009  IPR000719  IPR001245  IPR008266  
  • Prosite: PS50835 PS50011 PS00109
  • STRING: ENSP00000418754
• Other Databases: GeneCards:  PTK7  Malacards:  PTK7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1904929	coreceptor activity involved in Wnt signaling pathway, planar cell polarity pathway	NAS	molecular function
GO:0003401	axis elongation	IBA	biological process
GO:0005911	cell-cell junction	IBA	cellular component
GO:0001736	establishment of planar polarity	IBA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060976	coronary vasculature development	IEA	biological process
GO:0060484	lung-associated mesenchyme development	IEA	biological process
GO:0060026	convergent extension	IEA	biological process
GO:0042060	wound healing	IEA	biological process
GO:0005911	cell-cell junction	IEA	cellular component
GO:0003401	axis elongation	IEA	biological process
GO:0090179	planar cell polarity pathway involved in neural tube closure	IEA	biological process
GO:0090103	cochlea morphogenesis	IEA	biological process
GO:0045198	establishment of epithelial cell apical/basal polarity	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007507	heart development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0003281	ventricular septum development	IEA	biological process
GO:0001843	neural tube closure	IEA	biological process
GO:0001736	establishment of planar polarity	IEA	biological process
GO:0010976	positive regulation of neuron projection development	IMP	biological process
GO:0071300	cellular response to retinoic acid	IMP	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005911	cell-cell junction	IDA	cellular component
GO:0016477	cell migration	IMP	biological process
GO:0005925	focal adhesion	HDA	cellular component
GO:0090263	positive regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0031532	actin cytoskeleton reorganization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R