• Gene id: 57515

Gene Summary

• Gene Symbol: SERINC1   Gene   UCSC   Ensembl
• Aliases: TDE1L, TDE2, TMS-2, TMS2
• Gene name: serine incorporator 1
• Alternate names: serine incorporator 1, tumor differentially expressed protein 2,
• Gene location: 6q22.31 (122471806: 122443350)     Exons: 6     NC_000006.12
• OMIM: 614548

Protein Summary

• Protein general information: Q9NRX5  
  • Name: Serine incorporator 1 (Tumor differentially expressed protein 1 like) (Tumor differentially expressed protein 2)
  • Length: 453  
  • Mass: 50495
• Sequence:

  MGSVLGLCSMASWIPCLCGSAPCLLCRCCPSGNNSTVTRLIYALFLLVGVCVACVMLIPGMEEQLNKIPGFCENE
  KGVVPCNILVGYKAVYRLCFGLAMFYLLLSLLMIKVKSSSDPRAAVHNGFWFFKFAAAIAIIIGAFFIPEGTFTT
  VWFYVGMAGAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATALNYLLSLVAIVLFFVYYTHPAS
  CSENKAFISVNMLLCVGASVMSILPKIQESQPRSGLLQSSVITVYTMYLTWSAMTNEPETNCNPSLLSIIGYNTT
  STVPKEGQSVQWWHAQGIIGLILFLLCVFYSSIRTSNNSQVNKLTLTSDESTLIEDGGARSDGSLEDGDDVHRAV
  DNERDGVTYSYSFFHFMLFLASLYIMMTLTNWYRYEPSREMKSQWTAVWVKISSSWIGIVLYVWTLVAPLVLTNR
  DFD

• Structural information:
  • Interpro: IPR029557  IPR005016  
  • STRING: ENSP00000342962
• Other Databases: GeneCards:  SERINC1  Malacards:  SERINC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006665	sphingolipid metabolic process	ISS	biological process
GO:0006658	phosphatidylserine metabolic process	ISS	biological process
GO:0005789	endoplasmic reticulum membrane	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0016020	membrane	IBA	cellular component
GO:0006665	sphingolipid metabolic process	IEA	biological process
GO:0006658	phosphatidylserine metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0008654	phospholipid biosynthetic process	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0006665	sphingolipid metabolic process	IEA	biological process
GO:1904219	positive regulation of CDP-diacylglycerol-serine O-phosphatidyltransferase activity	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0006658	phosphatidylserine metabolic process	IEA	biological process
GO:0019899	enzyme binding	IEA	molecular function
GO:0030674	protein-macromolecule adaptor activity	IEA	molecular function
GO:0044091	membrane biogenesis	IEA	biological process
GO:1904222	positive regulation of serine C-palmitoyltransferase activity	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:1904222	positive regulation of serine C-palmitoyltransferase activity	ISS	biological process
GO:1904219	positive regulation of CDP-diacylglycerol-serine O-phosphatidyltransferase activity	ISS	biological process
GO:0030674	protein-macromolecule adaptor activity	ISS	molecular function
GO:0044091	membrane biogenesis	ISS	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)