• Gene id: 57506

Gene Summary

• Gene Symbol: MAVS   Gene   UCSC   Ensembl
• Aliases: CARDIF, IPS-1, IPS1, VISA
• Gene name: mitochondrial antiviral signaling protein
• Alternate names: mitochondrial antiviral-signaling protein, CARD adapter inducing interferon beta, CARD adaptor inducing IFN-beta, IFN-B promoter stimulator 1, interferon beta promoter stimulator protein 1, putative NF-kappa-B-activating protein 031N, virus-induced signaling ad,
• Gene location: 20p13 (3846798: 3876122)     Exons: 7     NC_000020.11
• Gene summary(Entrez): This gene encodes an intermediary protein necessary in the virus-triggered beta interferon signaling pathways. It is required for activation of transcription factors which regulate expression of beta interferon and contributes to antiviral immunity. Multi
• OMIM: 609568

Protein Summary

• Protein general information: Q7Z434  
  • Name: Mitochondrial antiviral signaling protein (MAVS) (CARD adapter inducing interferon beta) (Cardif) (Interferon beta promoter stimulator protein 1) (IPS 1) (Putative NF kappa B activating protein 031N) (Virus induced signaling adapter) (VISA)
  • Length: 540  
  • Mass: 56528
  • Tissue specificity: Present in T-cells, monocytes, epithelial cells and hepatocytes (at protein level). Ubiquitously expressed, with highest levels in heart, skeletal muscle, liver, placenta and peripheral blood leukocytes. {ECO
• Sequence:

  MPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRRPGWVEYFIAA
  LRGCELVDLADEVASVYQSYQPRTSDRPPDPLEPPSLPAERPGPPTPAAAHSIPYNSCREKEPSYPMPVQETQAP
  ESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGHQEQDTELGSTHTAGATSSLTPSRGPVSPSV
  SFQPLARSTPRASRLPGPTGSVVSTGTSFSSSSPGLASAGAAEGKQGAESDQAEPIICSSGAEAPANSLPSKVPT
  TLMPVNTVALKVPANPASVSTVPSKLPTSSKPPGAVPSNALTNPAPSKLPINSTRAGMVPSKVPTSMVLTKVSAS
  TVPTDGSSRNEETPAAPTPAGATGGSSAWLDSSSENRGLGSELSKPGVLASQVDSPFSGCFEDLAISASTSLGMG
  PCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQVAVTGV
  LVVTLLVVLYRRRLH

• Structural information:
  • Protein Domains: (10..7-)
    (/note="CARD"-)
  • Interpro: IPR031964  IPR042144  IPR026148  
  • CDD: cd08811
  • PDB: 2MS7 2MS8 2VGQ 3J6C 3J6J 3RC5 4P4H 4Z8M 5JEK
  • PDBsum: 2MS7 2MS8 2VGQ 3J6C 3J6J 3RC5 4P4H 4Z8M 5JEK
  • DIP: 35445
  • STRING: ENSP00000401980
• Other Databases: GeneCards:  MAVS  Malacards:  MAVS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045087	innate immune response	IMP	biological process
GO:0045087	innate immune response	IMP	biological process
GO:0060760	positive regulation of response to cytokine stimulus	IMP	biological process
GO:0002735	positive regulation of myeloid dendritic cell cytokine production	ISS	biological process
GO:0042742	defense response to bacterium	IMP	biological process
GO:0032728	positive regulation of interferon-beta production	IMP	biological process
GO:0032728	positive regulation of interferon-beta production	IMP	biological process
GO:0032727	positive regulation of interferon-alpha production	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002230	positive regulation of defense response to virus by host	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1902741	positive regulation of interferon-alpha secretion	IMP	biological process
GO:0071360	cellular response to exogenous dsRNA	IMP	biological process
GO:0035549	positive regulation of interferon-beta secretion	IMP	biological process
GO:1904469	positive regulation of tumor necrosis factor secretion	IMP	biological process
GO:2000778	positive regulation of interleukin-6 secretion	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0032480	negative regulation of type I interferon production	TAS	biological process
GO:0045087	innate immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050700	CARD domain binding	IPI	molecular function
GO:0050700	CARD domain binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0032757	positive regulation of interleukin-8 production	IDA	biological process
GO:0042307	positive regulation of protein import into nucleus	IDA	biological process
GO:0060340	positive regulation of type I interferon-mediated signaling pathway	IDA	biological process
GO:0071651	positive regulation of chemokine (C-C motif) ligand 5 production	IDA	biological process
GO:0071660	positive regulation of IP-10 production	IDA	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0002230	positive regulation of defense response to virus by host	IDA	biological process
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0032727	positive regulation of interferon-alpha production	IDA	biological process
GO:0032728	positive regulation of interferon-beta production	IDA	biological process
GO:0032760	positive regulation of tumor necrosis factor production	IDA	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0002218	activation of innate immune response	IMP	biological process
GO:0071360	cellular response to exogenous dsRNA	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0031966	mitochondrial membrane	IDA	cellular component
GO:0005778	peroxisomal membrane	IDA	cellular component
GO:0045071	negative regulation of viral genome replication	IDA	biological process
GO:0060340	positive regulation of type I interferon-mediated signaling pathway	IDA	biological process
GO:0051607	defense response to virus	IDA	biological process
GO:0051607	defense response to virus	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1900063	regulation of peroxisome organization	IMP	biological process
GO:0007165	signal transduction	IMP	biological process
GO:0035591	signaling adaptor activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	HMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection
hsa05169	Epstein-Barr virus infection
hsa04621	NOD-like receptor signaling pathway
hsa05164	Influenza A
hsa05161	Hepatitis B
hsa05160	Hepatitis C
hsa05162	Measles
hsa04622	RIG-I-like receptor signaling pathway
hsa04623	Cytosolic DNA-sensing pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq