• Gene id: 57486

Gene Summary

• Gene Symbol: NLN   Gene   UCSC   Ensembl
• Aliases: AGTBP, EP24.16, MEP, MOP
• Gene name: neurolysin
• Alternate names: neurolysin, mitochondrial, angiotensin binding protein, endopeptidase 24.16, microsomal endopeptidase, mitochondrial oligopeptidase M, neurolysin (metallopeptidase M3 family), neurotensin endopeptidase,
• Gene location: 5q12.3 (65722204: 65829282)     Exons: 14     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of the metallopeptidase M3 protein family that cleaves neurotensin at the Pro10-Tyr11 bond, leading to the formation of neurotensin(1-10) and neurotensin(11-13). The encoded protein is likely involved in the termination of the n
• OMIM: 611530

Protein Summary

• Protein general information: Q9BYT8  
  • Name: Neurolysin, mitochondrial (EC 3.4.24.16) (Angiotensin binding protein) (Microsomal endopeptidase) (MEP) (Mitochondrial oligopeptidase M) (Neurotensin endopeptidase)
  • Length: 704  
  • Mass: 80652
• Sequence:

  MIARCLLAVRSLRRVGGSRILLRMTLGREVMSPLQAMSSYTVAGRNVLRWDLSPEQIKTRTEELIVQTKQVYDAV
  GMLGIEEVTYENCLQALADVEVKYIVERTMLDFPQHVSSDKEVRAASTEADKRLSRFDIEMSMRGDIFERIVHLQ
  ETCDLGKIKPEARRYLEKSIKMGKRNGLHLPEQVQNEIKSMKKRMSELCIDFNKNLNEDDTFLVFSKAELGALPD
  DFIDSLEKTDDDKYKITLKYPHYFPVMKKCCIPETRRRMEMAFNTRCKEENTIILQQLLPLRTKVAKLLGYSTHA
  DFVLEMNTAKSTSRVTAFLDDLSQKLKPLGEAEREFILNLKKKECKDRGFEYDGKINAWDLYYYMTQTEELKYSI
  DQEFLKEYFPIEVVTEGLLNTYQELLGLSFEQMTDAHVWNKSVTLYTVKDKATGEVLGQFYLDLYPREGKYNHAA
  CFGLQPGCLLPDGSRMMAVAALVVNFSQPVAGRPSLLRHDEVRTYFHEFGHVMHQICAQTDFARFSGTNVETDFV
  EVPSQMLENWVWDVDSLRRLSKHYKDGSPIADDLLEKLVASRLVNTGLLTLRQIVLSKVDQSLHTNTSLDAASEY
  AKYCSEILGVAATPGTNMPATFGHLAGGYDGQYYGYLWSEVFSMDMFYSCFKKEGIMNPEVGMKYRNLILKPGGS
  LDGMDMLHNFLKREPNQKAFLMSRGLHAP

• Structural information:
  • Interpro: IPR024079  IPR024077  IPR024080  IPR001567  
  • Prosite: PS00142
  • PDB: 5LUZ 5LV0
  • PDBsum: 5LUZ 5LV0
  • STRING: ENSP00000370372
• Other Databases: GeneCards:  NLN  Malacards:  NLN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006508	proteolysis	IBA	biological process
GO:0006518	peptide metabolic process	IBA	biological process
GO:0004222	metalloendopeptidase activity	IBA	molecular function
GO:0005758	mitochondrial intermembrane space	IBA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004222	metalloendopeptidase activity	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0008233	peptidase activity	IEA	molecular function
GO:1902809	regulation of skeletal muscle fiber differentiation	IEA	biological process
GO:0042277	peptide binding	IEA	molecular function
GO:0006111	regulation of gluconeogenesis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005758	mitochondrial intermembrane space	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04614	Renin-angiotensin system

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881