• Gene id: 57463

Gene Summary

• Gene Symbol: AMIGO1   Gene   UCSC   Ensembl
• Aliases: ALI2, AMIGO, AMIGO-1
• Gene name: adhesion molecule with Ig like domain 1
• Alternate names: amphoterin-induced protein 1, alivin-2, amphoterin-induced gene and ORF,
• Gene location: 1p13.3 (109509741: 109504177)     Exons: 2     NC_000001.11
• OMIM: 617886

Protein Summary

• Protein general information: Q86WK6  
  • Name: Amphoterin induced protein 1 (AMIGO 1) (Alivin 2)
  • Length: 493  
  • Mass: 55239
• Sequence:

  MHPHRDPRGLWLLLPSLSLLLFEVARAGRAVVSCPAACLCASNILSCSKQQLPNVPHSLPSYTALLDLSHNNLSR
  LRAEWTPTRLTQLHSLLLSHNHLNFISSEAFSPVPNLRYLDLSSNQLRTLDEFLFSDLQVLEVLLLYNNHIMAVD
  RCAFDDMAQLQKLYLSQNQISRFPLELVKEGAKLPKLTLLDLSSNKLKNLPLPDLQKLPAWIKNGLYLHNNPLNC
  DCELYQLFSHWQYRQLSSVMDFQEDLYCMNSKKLHNVFNLSFLNCGEYKERAWEAHLGDTLIIKCDTKQQGMTKV
  WVTPSNERVLDEVTNGTVSVSKDGSLLFQQVQVEDGGVYTCYAMGETFNETLSVELKVHNFTLHGHHDTLNTAYT
  TLVGCILSVVLVLIYLYLTPCRCWCRGVEKPSSHQGDSLSSSMLSTTPNHDPMAGGDKDDGFDRRVAFLEPAGPG
  QGQNGKLKPGNTLPVPEATGKGQRRMSDPESVSSVFSDTPIVV

• Structural information:
  • Protein Domains: (28..6-)
    (/note="LRRNT-)
    (221..27-)
    (/note="LRRCT-)
    (269..35-)
    (/note="Ig-like-C2-type)
    (/evidence="ECO:0000255"-)
  • Interpro: IPR031283  IPR031284  IPR000483  IPR007110  IPR036179   IPR013783  IPR013098  IPR003599  IPR001611  IPR003591  IPR032675  
  • Prosite: PS50835 PS51450
  • STRING: ENSP00000358880
• Other Databases: GeneCards:  AMIGO1  Malacards:  AMIGO1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IBA	cellular component
GO:0007420	brain development	IBA	biological process
GO:0030425	dendrite	ISS	cellular component
GO:1901381	positive regulation of potassium ion transmembrane transport	ISS	biological process
GO:0032809	neuronal cell body membrane	ISS	cellular component
GO:0008076	voltage-gated potassium channel complex	ISS	colocalizes with
GO:0015459	potassium channel regulator activity	ISS	molecular function
GO:0042552	myelination	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0007413	axonal fasciculation	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1901381	positive regulation of potassium ion transmembrane transport	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:1905232	cellular response to L-glutamate	IEA	biological process
GO:1903818	positive regulation of voltage-gated potassium channel activity	IEA	biological process
GO:0106030	neuron projection fasciculation	IEA	biological process
GO:0050772	positive regulation of axonogenesis	IEA	biological process
GO:0042552	myelination	IEA	biological process
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IEA	biological process
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0032809	neuronal cell body membrane	IEA	cellular component
GO:0015459	potassium channel regulator activity	IEA	molecular function
GO:0008076	voltage-gated potassium channel complex	IEA	cellular component
GO:1990030	pericellular basket	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0007420	brain development	IEA	biological process
GO:0007413	axonal fasciculation	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	ISS	biological process
GO:0042552	myelination	ISS	biological process
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	ISS	biological process
GO:0007413	axonal fasciculation	ISS	biological process
GO:0050772	positive regulation of axonogenesis	ISS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq