• Gene id: 57447

Gene Summary

• Gene Symbol: NDRG2   Gene   UCSC   Ensembl
• Aliases: SYLD
• Gene name: NDRG family member 2
• Alternate names: protein NDRG2, N-myc downstream regulator 2, N-myc downstream-regulated gene 2 protein, NDR1-related protein NDR2, cytoplasmic protein Ndr1, syld709613 protein,
• Gene location: 14q11.2 (21070871: 21016762)     Exons: 24     NC_000014.9
• Gene summary(Entrez): This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblast
• OMIM: 605272

Protein Summary

• Protein general information: Q9UN36  
  • Name: Protein NDRG2 (N myc downstream regulated gene 2 protein) (Protein Syld709613) [Cleaved into: Protein NDRG2, N terminally processed]
  • Length: 371  
  • Mass: 40,798
  • Tissue specificity: Ubiquitously expressed. {ECO
• Sequence:

  MAELQEVQITEEKPLLPGQTPEAAKEAELAARILLDQGQTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNY
  KSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAY
  ILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAP
  NLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQP
  GKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPGHTMEVSC

• Structural information:
  • Interpro: IPR029058  IPR004142  IPR030690  
  • PDB: 2XMQ 2XMR 2XMS
  • PDBsum: 2XMQ 2XMR 2XMS
  • STRING: ENSP00000298687
• Other Databases: GeneCards:  NDRG2  Malacards:  NDRG2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001818	negative regulation of cytokine production	IEA	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005815	microtubule organizing center	IDA	cellular component
GO:0005829	cytosol	NAS	cellular component
GO:0007165	signal transduction	IBA	biological process
GO:0010574	regulation of vascular endothelial growth factor production	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0021762	substantia nigra development	IEP	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0030426	growth cone	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0048662	negative regulation of smooth muscle cell proliferation	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0090361	regulation of platelet-derived growth factor production	IEA	biological process
GO:0001818	negative regulation of cytokine production	IEA	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005815	microtubule organizing center	IDA	cellular component
GO:0005829	cytosol	NAS	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	IBA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0010574	regulation of vascular endothelial growth factor production	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0021762	substantia nigra development	IEP	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0030426	growth cone	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0048662	negative regulation of smooth muscle cell proliferation	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0090361	regulation of platelet-derived growth factor production	IEA	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005815	microtubule organizing center	IDA	cellular component
GO:0005829	cytosol	NAS	cellular component
GO:0007165	signal transduction	IBA	biological process
GO:0021762	substantia nigra development	IEP	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component

Diseases

Associated diseases	References
Blood pressure	GAD: 17903302
Leydig cell dysfunction	MIK: 22138128
Hypospermatogenesis	MIK: 22138128
Sertoli cell only syndrome (SCOS)	MIK: 22138128
Male factor infertility	MIK: 22138128
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Leydig cell apoptosis	MIK: 22138128
Male sterility	MIK: 22138128
Sertoli cell only syndrome	MIK: 22138128
Hypospermatogenesis	MIK: 22138128
Regulates testicular development and spermatogenesis in rat	MIK: 19471968
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
22138128	Leydig cell apoptosis, Male sterility, Sertoli cell only syndrome, hypospermatogenesis			50 (17 men with nonobstructive azoospermia, 8 men with obstructive azoospermia, 8 normal, 6 hypospermatogenesis, 6 congenital SCO, 5 secondary SCO)	Male infertility
19471968	Regulates testicular development and spermatogenesis in rat				Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray