Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 5743
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol PTGS2   Gene   UCSC   Ensembl
Aliases COX-2, COX2, GRIPGHS, PGG/HS, PGHS-2, PHS-2, hCox-2
Gene name prostaglandin-endoperoxide synthase 2
Alternate names prostaglandin G/H synthase 2, PGH synthase 2, PHS II, cyclooxygenase 2, cyclooxygenase 2b, prostaglandin H2 synthase 2, prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase),
Gene location 1q31.1 (186680426: 186671811)     Exons: 10     NC_000001.11
Gene summary(Entrez) Prostaglandin-endoperoxide synthase (PTGS), also known as cyclooxygenase, is the key enzyme in prostaglandin biosynthesis, and acts both as a dioxygenase and as a peroxidase. There are two isozymes of PTGS: a constitutive PTGS1 and an inducible PTGS2, whi
OMIM 600262

Protein Summary
Protein general information P35354  

Name: Prostaglandin G/H synthase 2 (EC 1.14.99.1) (Cyclooxygenase 2) (COX 2) (PHS II) (Prostaglandin H2 synthase 2) (PGH synthase 2) (PGHS 2) (Prostaglandin endoperoxide synthase 2)

Length: 604  Mass: 68,996

Tissue specificity: Ubiquitously expressed. {ECO

Sequence MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFLTRIKLFLKPTPNTVH
YILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADYGYKSWEAFSNLSYYTRALPPVPDDCPTPLG
VKGKKQLPDSNEIVEKLLLRRKFIPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLA
RQRKLRLFKDGKMKYQIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQNRIAAEFNTLYHWHP
LLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRVAGGRNVPPAVQKVSQASIDQSRQMKYQSFN
EYRKRFMLKPYESFEELTGEKEMSAELEALYGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVI
CSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKER
STEL
Structural information
Protein Domains
 EGF-like. (18-55)
Interpro:  IPR029576  IPR000742  IPR010255  IPR019791  IPR037120  
Prosite:   PS50026 PS50292

PDB:  		 1V0X 5F19 5F1A 5IKQ 5IKR 5IKT 5IKV 5KIR
PDBsum:   1V0X 5F19 5F1A 5IKQ 5IKR 5IKT 5IKV 5KIR

DIP:  
28131
STRING:   ENSP00000356438
Other Databases GeneCards:  PTGS2  Malacards:  PTGS2

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0001516 prostaglandin biosyntheti
c process
 ISS biological process
GO:0001516 prostaglandin biosyntheti
c process
 NAS biological process
GO:0001525 angiogenesis
 IEA biological process
GO:0004601 peroxidase activity
 NAS molecular function
GO:0004601 peroxidase activity
 TAS molecular function
GO:0004666 prostaglandin-endoperoxid
e synthase activity
 IDA molecular function
GO:0004666 prostaglandin-endoperoxid
e synthase activity
 IDA molecular function
GO:0004666 prostaglandin-endoperoxid
e synthase activity
 TAS molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005634 nucleus
 ISS cellular component
GO:0005737 cytoplasm
 ISS cellular component
GO:0005737 cytoplasm
 IDA cellular component
GO:0005783 endoplasmic reticulum
 IDA cellular component
GO:0005788 endoplasmic reticulum lum
en
 TAS cellular component
GO:0005789 endoplasmic reticulum mem
brane
 TAS cellular component
GO:0005789 endoplasmic reticulum mem
brane
 TAS cellular component
GO:0005789 endoplasmic reticulum mem
brane
 TAS cellular component
GO:0005789 endoplasmic reticulum mem
brane
 TAS cellular component
GO:0005789 endoplasmic reticulum mem
brane
 TAS cellular component
GO:0005901 caveola
 IEA cellular component
GO:0006693 prostaglandin metabolic p
rocess
 TAS biological process
GO:0006769 nicotinamide metabolic pr
ocess
 TAS biological process
GO:0006928 movement of cell or subce
llular component
 TAS biological process
GO:0006954 inflammatory response
 IEA biological process
GO:0006979 response to oxidative str
ess
 IEA biological process
GO:0007566 embryo implantation
 IEA biological process
GO:0007612 learning
 IEA biological process
GO:0007613 memory
 IEA biological process
GO:0008217 regulation of blood press
ure
 ISS biological process
GO:0008285 negative regulation of ce
ll proliferation
 IEA biological process
GO:0008289 lipid binding
 IEA molecular function
GO:0009750 response to fructose
 IEA biological process
GO:0010042 response to manganese ion
 IEA biological process
GO:0010226 response to lithium ion
 IEA biological process
GO:0010575 positive regulation of va
scular endothelial growth
factor production
 ISS biological process
GO:0019233 sensory perception of pai
n
 IEA biological process
GO:0019371 cyclooxygenase pathway
 IDA biological process
GO:0019371 cyclooxygenase pathway
 TAS biological process
GO:0019372 lipoxygenase pathway
 TAS biological process
GO:0019899 enzyme binding
 IPI molecular function
GO:0020037 heme binding
 ISS molecular function
GO:0030282 bone mineralization
 IEA biological process
GO:0030728 ovulation
 IEA biological process
GO:0031394 positive regulation of pr
ostaglandin biosynthetic
process
 NAS biological process
GO:0031622 positive regulation of fe
ver generation
 ISS biological process
GO:0031915 positive regulation of sy
naptic plasticity
 IEA biological process
GO:0032227 negative regulation of sy
naptic transmission, dopa
minergic
 IEA biological process
GO:0032355 response to estradiol
 IEA biological process
GO:0032496 response to lipopolysacch
aride
 IEA biological process
GO:0033280 response to vitamin D
 IEA biological process
GO:0034612 response to tumor necrosi
s factor
 IEA biological process
GO:0034644 cellular response to UV
 IEA biological process
GO:0035633 maintenance of permeabili
ty of blood-brain barrier
 IEA biological process
GO:0042346 positive regulation of NF
-kappaB import into nucle
us
 IEA biological process
GO:0042493 response to drug
 IEA biological process
GO:0042633 hair cycle
 IEA biological process
GO:0042803 protein homodimerization
activity
 IEA molecular function
GO:0043005 neuron projection
 IDA cellular component
GO:0043065 positive regulation of ap
optotic process
 IEA biological process
GO:0043234 protein complex
 IEA cellular component
GO:0045429 positive regulation of ni
tric oxide biosynthetic p
rocess
 ISS biological process
GO:0045786 negative regulation of ce
ll cycle
 IEA biological process
GO:0045907 positive regulation of va
soconstriction
 IEA biological process
GO:0045986 negative regulation of sm
ooth muscle contraction
 IEA biological process
GO:0045987 positive regulation of sm
ooth muscle contraction
 IEA biological process
GO:0046697 decidualization
 IEA biological process
GO:0046872 metal ion binding
 IEA molecular function
GO:0048661 positive regulation of sm
ooth muscle cell prolifer
ation
 IEA biological process
GO:0050473 arachidonate 15-lipoxygen
ase activity
 TAS molecular function
GO:0050727 regulation of inflammator
y response
 NAS biological process
GO:0050873 brown fat cell differenti
ation
 IEA biological process
GO:0051384 response to glucocorticoi
d
 IEA biological process
GO:0051926 negative regulation of ca
lcium ion transport
 IEA biological process
GO:0051968 positive regulation of sy
naptic transmission, glut
amatergic
 IEA biological process
GO:0055114 oxidation-reduction proce
ss
 IEA biological process
GO:0070542 response to fatty acid
 IEA biological process
GO:0071260 cellular response to mech
anical stimulus
 IEA biological process
GO:0071318 cellular response to ATP
 IEA biological process
GO:0071456 cellular response to hypo
xia
 IEP biological process
GO:0071498 cellular response to flui
d shear stress
 IEA biological process
GO:0071636 positive regulation of tr
ansforming growth factor
beta production
 ISS biological process
GO:0090050 positive regulation of ce
ll migration involved in
sprouting angiogenesis
 ISS biological process
GO:0090271 positive regulation of fi
broblast growth factor pr
oduction
 ISS biological process
GO:0090336 positive regulation of br
own fat cell differentiat
ion
 ISS biological process
GO:0090362 positive regulation of pl
atelet-derived growth fac
tor production
 ISS biological process
GO:0098869 cellular oxidant detoxifi
cation
 IEA biological process
GO:0001516 prostaglandin biosyntheti
c process
 IEA biological process
GO:0001516 prostaglandin biosyntheti
c process
 IEA biological process
GO:0001516 prostaglandin biosyntheti
c process
 ISS biological process
GO:0001516 prostaglandin biosyntheti
c process
 IEA biological process
GO:0001516 prostaglandin biosyntheti
c process
 IEA biological process
GO:0001516 prostaglandin biosyntheti
c process
 NAS biological process
GO:0001525 angiogenesis
 IEA biological process
GO:0004601 peroxidase activity
 IEA molecular function
GO:0004601 peroxidase activity
 IEA molecular function
GO:0004601 peroxidase activity
 NAS molecular function
GO:0004601 peroxidase activity
 TAS molecular function
GO:0004666 prostaglandin-endoperoxid
e synthase activity
 IEA molecular function
GO:0004666 prostaglandin-endoperoxid
e synthase activity
 IEA molecular function
GO:0004666 prostaglandin-endoperoxid
e synthase activity
 IEA molecular function
GO:0004666 prostaglandin-endoperoxid
e synthase activity
 IDA molecular function
GO:0004666 prostaglandin-endoperoxid
e synthase activity
 IDA molecular function
GO:0004666 prostaglandin-endoperoxid
e synthase activity
 TAS molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005634 nucleus
 ISS cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005737 cytoplasm
 ISS cellular component
GO:0005737 cytoplasm
 IDA cellular component
GO:0005783 endoplasmic reticulum
 IEA cellular component
GO:0005783 endoplasmic reticulum
 IDA cellular component
GO:0005788 endoplasmic reticulum lum
en
 TAS cellular component
GO:0005789 endoplasmic reticulum mem
brane
 IEA cellular component
GO:0005789 endoplasmic reticulum mem
brane
 TAS cellular component
GO:0005789 endoplasmic reticulum mem
brane
 TAS cellular component
GO:0005789 endoplasmic reticulum mem
brane
 TAS cellular component
GO:0005789 endoplasmic reticulum mem
brane
 TAS cellular component
GO:0005789 endoplasmic reticulum mem
brane
 TAS cellular component
GO:0005901 caveola
 IEA cellular component
GO:0006629 lipid metabolic process
 IEA biological process
GO:0006631 fatty acid metabolic proc
ess
 IEA biological process
GO:0006633 fatty acid biosynthetic p
rocess
 IEA biological process
GO:0006693 prostaglandin metabolic p
rocess
 IEA biological process
GO:0006693 prostaglandin metabolic p
rocess
 TAS biological process
GO:0006769 nicotinamide metabolic pr
ocess
 TAS biological process
GO:0006928 movement of cell or subce
llular component
 TAS biological process
GO:0006954 inflammatory response
 IEA biological process
GO:0006954 inflammatory response
 IEA biological process
GO:0006979 response to oxidative str
ess
 IEA biological process
GO:0007566 embryo implantation
 IEA biological process
GO:0007612 learning
 IEA biological process
GO:0007613 memory
 IEA biological process
GO:0008217 regulation of blood press
ure
 IEA biological process
GO:0008217 regulation of blood press
ure
 IEA biological process
GO:0008217 regulation of blood press
ure
 ISS biological process
GO:0008284 positive regulation of ce
ll proliferation
 IEA biological process
GO:0008285 negative regulation of ce
ll proliferation
 IEA biological process
GO:0008289 lipid binding
 IEA molecular function
GO:0009314 response to radiation
 IEA biological process
GO:0009750 response to fructose
 IEA biological process
GO:0010033 response to organic subst
ance
 IEA biological process
GO:0010042 response to manganese ion
 IEA biological process
GO:0010226 response to lithium ion
 IEA biological process
GO:0010243 response to organonitroge
n compound
 IEA biological process
GO:0010575 positive regulation of va
scular endothelial growth
factor production
 IEA biological process
GO:0010575 positive regulation of va
scular endothelial growth
factor production
 ISS biological process
GO:0010942 positive regulation of ce
ll death
 IEA biological process
GO:0014070 response to organic cycli
c compound
 IEA biological process
GO:0016020 membrane
 IEA cellular component
GO:0016491 oxidoreductase activity
 IEA molecular function
GO:0016702 oxidoreductase activity,
acting on single donors w
ith incorporation of mole
cular oxygen, incorporati
on of two atoms of oxygen
 IEA molecular function
GO:0019233 sensory perception of pai
n
 IEA biological process
GO:0019371 cyclooxygenase pathway
 IEA biological process
GO:0019371 cyclooxygenase pathway
 IEA biological process
GO:0019371 cyclooxygenase pathway
 IDA biological process
GO:0019371 cyclooxygenase pathway
 TAS biological process
GO:0019372 lipoxygenase pathway
 TAS biological process
GO:0019899 enzyme binding
 IPI molecular function
GO:0020037 heme binding
 IEA molecular function
GO:0020037 heme binding
 IEA molecular function
GO:0020037 heme binding
 ISS molecular function
GO:0030282 bone mineralization
 IEA biological process
GO:0030728 ovulation
 IEA biological process
GO:0031090 organelle membrane
 IEA cellular component
GO:0031394 positive regulation of pr
ostaglandin biosynthetic
process
 NAS biological process
GO:0031622 positive regulation of fe
ver generation
 IEA biological process
GO:0031622 positive regulation of fe
ver generation
 ISS biological process
GO:0031915 positive regulation of sy
naptic plasticity
 IEA biological process
GO:0032227 negative regulation of sy
naptic transmission, dopa
minergic
 IEA biological process
GO:0032355 response to estradiol
 IEA biological process
GO:0032496 response to lipopolysacch
aride
 IEA biological process
GO:0033280 response to vitamin D
 IEA biological process
GO:0034097 response to cytokine
 IEA biological process
GO:0034612 response to tumor necrosi
s factor
 IEA biological process
GO:0034644 cellular response to UV
 IEA biological process
GO:0035633 maintenance of permeabili
ty of blood-brain barrier
 IEA biological process
GO:0042127 regulation of cell prolif
eration
 IEA biological process
GO:0042346 positive regulation of NF
-kappaB import into nucle
us
 IEA biological process
GO:0042493 response to drug
 IEA biological process
GO:0042633 hair cycle
 IEA biological process
GO:0042803 protein homodimerization
activity
 IEA molecular function
GO:0043005 neuron projection
 IEA cellular component
GO:0043005 neuron projection
 IDA cellular component
GO:0043065 positive regulation of ap
optotic process
 IEA biological process
GO:0043231 intracellular membrane-bo
unded organelle
 IEA cellular component
GO:0043234 protein complex
 IEA cellular component
GO:0045429 positive regulation of ni
tric oxide biosynthetic p
rocess
 IEA biological process
GO:0045429 positive regulation of ni
tric oxide biosynthetic p
rocess
 ISS biological process
GO:0045786 negative regulation of ce
ll cycle
 IEA biological process
GO:0045907 positive regulation of va
soconstriction
 IEA biological process
GO:0045986 negative regulation of sm
ooth muscle contraction
 IEA biological process
GO:0045987 positive regulation of sm
ooth muscle contraction
 IEA biological process
GO:0046697 decidualization
 IEA biological process
GO:0046872 metal ion binding
 IEA molecular function
GO:0048661 positive regulation of sm
ooth muscle cell prolifer
ation
 IEA biological process
GO:0050473 arachidonate 15-lipoxygen
ase activity
 TAS molecular function
GO:0050727 regulation of inflammator
y response
 NAS biological process
GO:0050873 brown fat cell differenti
ation
 IEA biological process
GO:0051213 dioxygenase activity
 IEA molecular function
GO:0051384 response to glucocorticoi
d
 IEA biological process
GO:0051926 negative regulation of ca
lcium ion transport
 IEA biological process
GO:0051968 positive regulation of sy
naptic transmission, glut
amatergic
 IEA biological process
GO:0055114 oxidation-reduction proce
ss
 IEA biological process
GO:0055114 oxidation-reduction proce
ss
 IEA biological process
GO:0070542 response to fatty acid
 IEA biological process
GO:0071260 cellular response to mech
anical stimulus
 IEA biological process
GO:0071318 cellular response to ATP
 IEA biological process
GO:0071456 cellular response to hypo
xia
 IEP biological process
GO:0071498 cellular response to flui
d shear stress
 IEA biological process
GO:0071636 positive regulation of tr
ansforming growth factor
beta production
 IEA biological process
GO:0071636 positive regulation of tr
ansforming growth factor
beta production
 ISS biological process
GO:0090050 positive regulation of ce
ll migration involved in
sprouting angiogenesis
 IEA biological process
GO:0090050 positive regulation of ce
ll migration involved in
sprouting angiogenesis
 ISS biological process
GO:0090271 positive regulation of fi
broblast growth factor pr
oduction
 IEA biological process
GO:0090271 positive regulation of fi
broblast growth factor pr
oduction
 ISS biological process
GO:0090336 positive regulation of br
own fat cell differentiat
ion
 IEA biological process
GO:0090336 positive regulation of br
own fat cell differentiat
ion
 ISS biological process
GO:0090362 positive regulation of pl
atelet-derived growth fac
tor production
 IEA biological process
GO:0090362 positive regulation of pl
atelet-derived growth fac
tor production
 ISS biological process
GO:0098869 cellular oxidant detoxifi
cation
 IEA biological process
GO:0001516 prostaglandin biosyntheti
c process
 ISS biological process
GO:0001516 prostaglandin biosyntheti
c process
 NAS biological process
GO:0004601 peroxidase activity
 NAS molecular function
GO:0004601 peroxidase activity
 TAS molecular function
GO:0004666 prostaglandin-endoperoxid
e synthase activity
 IDA molecular function
GO:0004666 prostaglandin-endoperoxid
e synthase activity
 IDA molecular function
GO:0004666 prostaglandin-endoperoxid
e synthase activity
 TAS molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005634 nucleus
 ISS cellular component
GO:0005737 cytoplasm
 ISS cellular component
GO:0005737 cytoplasm
 IDA cellular component
GO:0005783 endoplasmic reticulum
 IDA cellular component
GO:0005788 endoplasmic reticulum lum
en
 TAS cellular component
GO:0005789 endoplasmic reticulum mem
brane
 TAS cellular component
GO:0005789 endoplasmic reticulum mem
brane
 TAS cellular component
GO:0005789 endoplasmic reticulum mem
brane
 TAS cellular component
GO:0005789 endoplasmic reticulum mem
brane
 TAS cellular component
GO:0005789 endoplasmic reticulum mem
brane
 TAS cellular component
GO:0006693 prostaglandin metabolic p
rocess
 TAS biological process
GO:0006769 nicotinamide metabolic pr
ocess
 TAS biological process
GO:0006928 movement of cell or subce
llular component
 TAS biological process
GO:0008217 regulation of blood press
ure
 ISS biological process
GO:0010575 positive regulation of va
scular endothelial growth
factor production
 ISS biological process
GO:0019371 cyclooxygenase pathway
 IDA biological process
GO:0019371 cyclooxygenase pathway
 TAS biological process
GO:0019372 lipoxygenase pathway
 TAS biological process
GO:0019899 enzyme binding
 IPI molecular function
GO:0020037 heme binding
 ISS molecular function
GO:0031394 positive regulation of pr
ostaglandin biosynthetic
process
 NAS biological process
GO:0031622 positive regulation of fe
ver generation
 ISS biological process
GO:0043005 neuron projection
 IDA cellular component
GO:0045429 positive regulation of ni
tric oxide biosynthetic p
rocess
 ISS biological process
GO:0050473 arachidonate 15-lipoxygen
ase activity
 TAS molecular function
GO:0050727 regulation of inflammator
y response
 NAS biological process
GO:0071456 cellular response to hypo
xia
 IEP biological process
GO:0071636 positive regulation of tr
ansforming growth factor
beta production
 ISS biological process
GO:0090050 positive regulation of ce
ll migration involved in
sprouting angiogenesis
 ISS biological process
GO:0090271 positive regulation of fi
broblast growth factor pr
oduction
 ISS biological process
GO:0090336 positive regulation of br
own fat cell differentiat
ion
 ISS biological process
GO:0090362 positive regulation of pl
atelet-derived growth fac
tor production
 ISS biological process

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa01100Metabolic pathways
hsa04064NF-kappa B signaling pathway
hsa04668TNF signaling pathway
hsa04625C-type lectin receptor signaling pathway
hsa04657IL-17 signaling pathway
hsa04923Regulation of lipolysis in adipocytes
hsa04913Ovarian steroidogenesis
hsa04921Oxytocin signaling pathway
hsa04726Serotonergic synapse
hsa04723Retrograde endocannabinoid signaling
hsa05200Pathways in cancer
hsa05206MicroRNAs in cancer
hsa05204Chemical carcinogenesis
hsa05222Small cell lung cancer
hsa05163Human cytomegalovirus infection
hsa05167Kaposi sarcoma-associated herpesvirus infection
hsa05165Human papillomavirus infection
hsa05140Leishmaniasis

Diseases

Expand All | Collapse All
Associated diseases References
Cancer (mouth) GAD: 19197984
Cancer (myeloma) GAD: 18997828
Cancer (nasopharyngeal) GAD: 17968676
Cancer (non-melanoma skin cancer) GAD: 17307204
Cholangiocarcinoma KEGG: H00046
Cancer (penile) KEGG: H00025
Cancer GAD: 20016751
Cancer (Adenocarcinoma) GAD: 18349295
Cancer (Adenoma) GAD: 19031967
Cancer (basal cell) GAD: 20445548
Cancer (bladder) GAD: 18381966
Cancer (brain) GAD: 16024651
Cancer (cervical) GAD: 17404026
Cancer (colon) GAD: 19437564
Cancer (colorectal) GAD: 16205694
Cancer (epithelial ovarian) GAD: 19064572
Cancer (esophageal) GAD: 16083713
Cancer (glioblastoma) GAD: 18006935
Cancer (head and neck) GAD: 19280666
Cancer (Hepatocellular) GAD: 21042835
Cancer (laryngeal) GAD: 17356794
Cancer (lung) GAD: 14604894
Cancer (lymphoma) GAD: 18038187
Cancer (ovarian) GAD: 20628624
Cancer (pancreatic) GAD: 19062735
Cancer (prostate) GAD: 14754878
Cancer (Squamous cell) GAD: 18922923
Cancer (stomach) GAD: 16733888
Cancer (esophageal) KEGG: H00017
Cancer (breast) GAD: 15596291
Cerebrovascular disease GAD: 16479190
Aneurysm GAD: 19625268
Angina pectoris GAD: 20299798
Atherosclerosis GAD: 16702043
Brain ischemia GAD: 19046748
Cardiovascular disease GAD: 15138244
Hypertension GAD: 15167446
Cystic fibrosis GAD: 20720307
Sarcoidosis GAD: 16840740
Hodgkin disease GAD: 19223558
Rheumatoid arthritis GAD: 16821264
Multiple sclerosis GAD: 17373929
Systemic lupus erythematosus (SLE) GAD: 16871410
Arthritis GAD: 18381795
Asthma GAD: 15544595
Inflammatory bowel disease GAD: 16273614
Diabetes GAD: 12920574
Metabolic syndrome GAD: 19056482
Osteoarthritis GAD: 16453284
Knee osteoarthritis GAD: 18471798
Alzheimer's disease GAD: 17234302
Amyotrophic lateral sclerosis (ALS) GAD: 18608101
Parkinson disease GAD: 17171651
Cerebral palsy GAD: 19238444
Hearing Loss GAD: 19898482
Depression GAD: 20034614
Psychological disorders GAD: 20034614
Schizophrenia GAD: 16181776
Autism GAD: 18579107
Chronic renal failure GAD: 21085059
Kidney diseases GAD: 19578796
Chorioamnionitis GAD: 20452482
Placenta diseases GAD: 17581413
Placenta diseases GAD: 17581413
Adenomyosis INFBASE: 19188819
Recurrent implantation failure (RIF) INFBASE: 20599859
Repeated failure of embryo implantation INFBASE: 19815191
Extrapelvic endometriosis INFBASE: 11605057
Ovarian endomerioma INFBASE: 18367179
Mixed atrophy INFBASE: 21683347
Ovarian endometriosis INFBASE: 18053993
Polycystic ovary syndrome (PCOS) INFBASE: 23900753
Oligoasthenoteratozoospermia MIK: 25906828
Leukocytospermia MIK: 26227162
Male factor infertility MIK: 24981555
Hypospermatogenesis MIK: 20188355
Spermatogenesis defects MIK: 17307169
Sertoli cell only syndrome (SCOS) MIK: 20188355
Varicocele MIK: 22747653
Spermatogenesis defects MIK: 21683347
Asthenozoospermia MIK: 24981555
Diminished ovarian reserve (DOR) INFBASE: 22906700, 22246450
Endometrial polyp INFBASE: 24471989
Endometriosis INFBASE: 24423359
Germ cell development MIK: 26192875
Implantation failure INFBASE: 20599859
Infertility GAD: 20599859
Chronic obstructive pulmonary disease (COPD) GAD: 18692035
Vitiligo GAD: 19004621
Connective tissue diseases GAD: 19527514
Chronic periodontitis GAD: 19236532
Atrophy GAD: 19448967
Oligohydramnios GAD: 18771989
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Asthenozoospermia MIK: 24981555
Hypospadias MIK: 24778562
Hypospermatogenesis MIK: 20188355
Germ cell arrest MIK: 20188355
Sertoli cell-only syndrome MIK: 20188355
Leukocytospermia MIK: 26227162
Idiopathic male infertility MIK: 26227162
Oligoasthenoteratozoospermia MIK: 25906828
Varicocele MIK: 25906828
Male infertility MIK: 25906828
Spermatogenic dysfunction MIK: 21683347
Varicocele MIK: 22747653
Mixed atrophy MIK: 21683347
Teratozoospermia MIK: 17327269
Male infertility MIK: 22747653

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
22747653 Varicocele
, Male inf
ertility

Male infertility
Show abstract
24981555 Asthenozoo
spermia
51 (28 infertil
e patients with
asthenozoosper
mia, 23 normosp
ermic fertile d
onors )
 Male infertility  IL-1?
COX-2
and HIF-1?
 Show abstract
26227162 Leukocytos
permia, id
iopathic m
ale infert
ility
85 (38 non-LCS
patients, 47 L
CS patients)
 Male infertility TLR-2/4
COX-2
and Nrf-2
 Show abstract
21683347 Spermatoge
nic dysfun
ction, mix
ed atrophy
19 (13 Mixed at
rophy cases, 6
controls)
 Male infertility PGD2 synthase
 Show abstract
20188355 Hyposperma
togenesis,
germ cell
arrest or
Sertoli c
ell-only s
yndrome

Male infertility COX-2
IL- 1beta
 Show abstract
25906828 Oligoasthe
noteratozo
ospermia,
varicocele
, male inf
ertility

Male infertility COX-1
COX-2
 Show abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract
24778562 Hypospadia
s
13 (5 controls,
8 cases)
 Male infertility Microarray
 Show abstract