• Gene id: 5742

Gene Summary

• Gene Symbol: PTGS1   Gene   UCSC   Ensembl
• Aliases: COX1, COX3, PCOX1, PES-1, PGG/HS, PGHS-1, PGHS1, PHS1, PTGHS
• Gene name: prostaglandin-endoperoxide synthase 1
• Alternate names: prostaglandin G/H synthase 1, PGH synthase 1, cyclooxygenase-1, prostaglandin H2 synthase 1, prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase),
• Gene location: 9q33.2 (122369905: 122395702)     Exons: 15     NC_000009.12
• Gene summary(Entrez): This is one of two genes encoding similar enzymes that catalyze the conversion of arachinodate to prostaglandin. The encoded protein regulates angiogenesis in endothelial cells, and is inhibited by nonsteroidal anti-inflammatory drugs such as aspirin. Bas
• OMIM: 176805

Protein Summary

• Protein general information: P23219  
  • Name: Prostaglandin G/H synthase 1 (EC 1.14.99.1) (Cyclooxygenase 1) (COX 1) (Prostaglandin H2 synthase 1) (PGH synthase 1) (PGHS 1) (PHS 1) (Prostaglandin endoperoxide synthase 1)
  • Length: 599  
  • Mass: 68,686
• Sequence:

  MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPGLWT
  WLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRSNLIPSPPTYNSAHDYISWESFSNVSYYTRI
  LPSVPKDCPTPMGTKGKKQLPDAQLLARRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGH
  GVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLY
  ATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGVQFQYRNR
  IAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDV
  IRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIG
  APFSLKGLLGNPICSPEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL

• Structural information:
  • Protein Domains: EGF-like. (31-69)
  • Interpro: IPR029580  IPR000742  IPR010255  IPR019791  IPR037120  
  • Prosite: PS50026 PS50292
  • STRING: ENSP00000354612
• Other Databases: GeneCards:  PTGS1  Malacards:  PTGS1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001516	prostaglandin biosynthetic process	ISS	biological process
GO:0001750	photoreceptor outer segment	IEA	cellular component
GO:0004601	peroxidase activity	TAS	molecular function
GO:0004666	prostaglandin-endoperoxide synthase activity	IDA	molecular function
GO:0004666	prostaglandin-endoperoxide synthase activity	TAS	molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0005635	nuclear envelope	IEA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0006629	lipid metabolic process	NAS	biological process
GO:0006805	xenobiotic metabolic process	TAS	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006979	response to oxidative stress	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0007612	learning	IEA	biological process
GO:0007613	memory	IEA	biological process
GO:0008217	regulation of blood pressure	ISS	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0010243	response to organonitrogen compound	IEA	biological process
GO:0010700	negative regulation of norepinephrine secretion	IEA	biological process
GO:0019233	sensory perception of pain	IEA	biological process
GO:0019371	cyclooxygenase pathway	IDA	biological process
GO:0019371	cyclooxygenase pathway	TAS	biological process
GO:0020037	heme binding	IEA	molecular function
GO:0032811	negative regulation of epinephrine secretion	IEA	biological process
GO:0035633	maintenance of permeability of blood-brain barrier	IEA	biological process
GO:0042127	regulation of cell proliferation	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	ISS	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0045907	positive regulation of vasoconstriction	IEA	biological process
GO:0045987	positive regulation of smooth muscle contraction	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0051213	dioxygenase activity	IEA	molecular function
GO:0051412	response to corticosterone	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070542	response to fatty acid	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0001516	prostaglandin biosynthetic process	IEA	biological process
GO:0001516	prostaglandin biosynthetic process	IEA	biological process
GO:0001516	prostaglandin biosynthetic process	ISS	biological process
GO:0001516	prostaglandin biosynthetic process	IEA	biological process
GO:0001516	prostaglandin biosynthetic process	IEA	biological process
GO:0001750	photoreceptor outer segment	IEA	cellular component
GO:0004601	peroxidase activity	IEA	molecular function
GO:0004601	peroxidase activity	IEA	molecular function
GO:0004601	peroxidase activity	TAS	molecular function
GO:0004666	prostaglandin-endoperoxide synthase activity	IEA	molecular function
GO:0004666	prostaglandin-endoperoxide synthase activity	IEA	molecular function
GO:0004666	prostaglandin-endoperoxide synthase activity	IDA	molecular function
GO:0004666	prostaglandin-endoperoxide synthase activity	TAS	molecular function
GO:0004666	prostaglandin-endoperoxide synthase activity	TAS	molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0005635	nuclear envelope	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0006629	lipid metabolic process	NAS	biological process
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0006633	fatty acid biosynthetic process	IEA	biological process
GO:0006693	prostaglandin metabolic process	IEA	biological process
GO:0006693	prostaglandin metabolic process	IEA	biological process
GO:0006805	xenobiotic metabolic process	TAS	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006979	response to oxidative stress	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0007612	learning	IEA	biological process
GO:0007613	memory	IEA	biological process
GO:0008217	regulation of blood pressure	IEA	biological process
GO:0008217	regulation of blood pressure	IEA	biological process
GO:0008217	regulation of blood pressure	ISS	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0010243	response to organonitrogen compound	IEA	biological process
GO:0010700	negative regulation of norepinephrine secretion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0019233	sensory perception of pain	IEA	biological process
GO:0019371	cyclooxygenase pathway	IEA	biological process
GO:0019371	cyclooxygenase pathway	IDA	biological process
GO:0019371	cyclooxygenase pathway	TAS	biological process
GO:0020037	heme binding	IEA	molecular function
GO:0031090	organelle membrane	IEA	cellular component
GO:0032811	negative regulation of epinephrine secretion	IEA	biological process
GO:0035633	maintenance of permeability of blood-brain barrier	IEA	biological process
GO:0042127	regulation of cell proliferation	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	ISS	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0045907	positive regulation of vasoconstriction	IEA	biological process
GO:0045987	positive regulation of smooth muscle contraction	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0051213	dioxygenase activity	IEA	molecular function
GO:0051412	response to corticosterone	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070542	response to fatty acid	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0001516	prostaglandin biosynthetic process	ISS	biological process
GO:0004601	peroxidase activity	TAS	molecular function
GO:0004666	prostaglandin-endoperoxide synthase activity	IDA	molecular function
GO:0004666	prostaglandin-endoperoxide synthase activity	TAS	molecular function
GO:0004666	prostaglandin-endoperoxide synthase activity	TAS	molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0006629	lipid metabolic process	NAS	biological process
GO:0006805	xenobiotic metabolic process	TAS	biological process
GO:0008217	regulation of blood pressure	ISS	biological process
GO:0019371	cyclooxygenase pathway	IDA	biological process
GO:0019371	cyclooxygenase pathway	TAS	biological process
GO:0043231	intracellular membrane-bounded organelle	ISS	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04611	Platelet activation
hsa04923	Regulation of lipolysis in adipocytes
hsa04726	Serotonergic synapse

Diseases

Associated diseases	References
Cancer	GAD: 19692168
Cancer (Adenoma)	GAD: 19205707
Cancer (bladder)	GAD: 19692168
Cancer (colorectal)	GAD: 15159324
Cancer (epithelial ovarian)	GAD: 19064572
Cancer (esophageal)	GAD: 20453000
Cancer (lung)	GAD: 18676680
Cancer (lymphoma)	GAD: 18636124
Cancer (ovarian)	GAD: 20628624
Cancer (stomach)	GAD: 18214026
Cancer (breast)	GAD: 19124506
Cardiovascular disease	GAD: 17495879
Hypertension	GAD: 19282863
Atherosclerosis	GAD: 16702043
Brain ischemia	GAD: 19046748
Vascular disease	GAD: 19132198
Cystic fibrosis	GAD: 20720307
Ulcerative colitis	GAD: 18705313
Asthma	GAD: 16055872
Metabolic syndrome	GAD: 19056482
Stroke	GAD: 15041270
Alzheimer's disease	GAD: 19141999
Schizophrenia	GAD: 16181776
Chronic renal failure	GAD: 21085059
Chorioamnionitis	GAD: 20452482
Endometriosis	INFBASE: 12468643
Oligoasthenoteratozoospermia	MIK: 25906828
Varicocele	MIK: 22747653
Male factor infertility	MIK: 25906828
Asthenozoospermia	MIK: 23645088
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Connective tissue diseases	GAD: 19527514
Atrophy	GAD: 17671743
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Asthenospermia	MIK: 23645088
Oligoasthenoteratozoospermia, varicocele, male infertility	MIK: 25906828
Teratozoospermia	MIK: 17327269
Varicocele	MIK: 22747653
Male infertility	MIK: 22747653

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
22747653	Varicocele, Male infertility				Male infertility
23645088	Asthenospermia	(m.9387 G>A) in COXIII	Tunisia n	166 (66 infertile men suffering from asthenospermia (n=34) in comparison to normospermic infertile men (n=32) and fertile men (n=100))	Male infertility	cytochrome oxidase I cytochrome oxidase II cytochrome oxidase III adenosine triphosphate synthase6 ATP synthase8 and cytochrome b
25906828	Oligoasthenoteratozoospermia, varicocele, male infertility				Male infertility	COX-1 COX-2
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881