• Gene id: 57419

Gene Summary

• Gene Symbol: SLC24A3   Gene   UCSC   Ensembl
• Aliases: NCKX3
• Gene name: solute carrier family 24 member 3
• Alternate names: sodium/potassium/calcium exchanger 3, Na(+)/K(+)/Ca(2+)-exchange protein 3, sodium calcium exchanger, solute carrier family 24 (sodium/potassium/calcium exchanger), member 3,
• Gene location: 20p11.23 (19212641: 19722925)     Exons: 17     NC_000020.11
• Gene summary(Entrez): Plasma membrane sodium/calcium exchangers are an important component of intracellular calcium homeostasis and electrical conduction. Potassium-dependent sodium/calcium exchangers such as SLC24A3 are believed to transport 1 intracellular calcium and 1 pota
• OMIM: 602872

Protein Summary

• Protein general information: Q9HC58  
  • Name: Sodium/potassium/calcium exchanger 3 (Na(+)/K(+)/Ca(2+) exchange protein 3) (Solute carrier family 24 member 3)
  • Length: 644  
  • Mass: 71992
  • Tissue specificity: Abundant in the brain. Expressed at low levels in the aorta, uterus and intestine.
• Sequence:

  MRPSGDEDRARRRRRRRRRRDLLLSQLCFLASVALLLWSLSSLREQKELDLMDLVGEDRKWMMARKLMQVNDTLT
  SEDAGLRNSKNCTEPALHEFPNDIFTNEDRRQGAVVLHVLCAIYMFYALAIVCDDFFVPSLEKICERLHLSEDVA
  GATFMAAGSSAPELFTSVIGVFITKGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVALSSWCLLRDSIYYTLSVI
  ALIVFIYDEKVSWWESLVLVLMYLIYIVIMKYNACIHQCFERRTKGAGNMVNGLANNAEIDDSSNCDATVVLLKK
  ANFHRKASVIMVDELLSAYPHQLSFSEAGLRIMITSHFPPKTRLSMASRMLINERQRLINSRAYTNGESEVAIKI
  PIKHTVENGTGPSSAPDRGVNGTRRDDVVAEAGNETENENEDNENDEEEEEDEDDDEGPYTPFDTPSGKLETVKW
  AFTWPLSFVLYFTVPNCNKPRWEKWFMVTFASSTLWIAAFSYMMVWMVTIIGYTLGIPDVIMGITFLAAGTSVPD
  CMASLIVARQGMGDMAVSNSIGSNVFDILIGLGLPWALQTLAVDYGSYIRLNSRGLIYSVGLLLASVFVTVFGVH
  LNKWQLDKKLGCGCLLLYGVFLCFSIMTEFNVFTFVNLPMCGDH

• Structural information:
  • Interpro: IPR004481  IPR004837  IPR030248  
  • STRING: ENSP00000333519
• Other Databases: GeneCards:  SLC24A3  Malacards:  SLC24A3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006874	cellular calcium ion homeostasis	IDA	biological process
GO:0035725	sodium ion transmembrane transport	IDA	biological process
GO:0071944	cell periphery	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0008273	calcium, potassium:sodium antiporter activity	IDA	molecular function
GO:0008273	calcium, potassium:sodium antiporter activity	ISS	molecular function
GO:0070588	calcium ion transmembrane transport	IDA	biological process
GO:0006874	cellular calcium ion homeostasis	ISS	biological process
GO:0071805	potassium ion transmembrane transport	IDA	biological process
GO:0071944	cell periphery	ISS	cellular component
GO:0071944	cell periphery	ISS	cellular component
GO:0044214	spanning component of plasma membrane	RCA	cellular component
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0010629	negative regulation of gene expression	ISS	biological process
GO:0010629	negative regulation of gene expression	ISS	biological process
GO:0010629	negative regulation of gene expression	ISS	biological process
GO:0010629	negative regulation of gene expression	ISS	biological process
GO:0010629	negative regulation of gene expression	ISS	biological process
GO:0010629	negative regulation of gene expression	ISS	biological process
GO:0010629	negative regulation of gene expression	ISS	biological process
GO:0030282	bone mineralization	ISS	biological process
GO:0005262	calcium channel activity	IBA	molecular function
GO:0006874	cellular calcium ion homeostasis	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0008273	calcium, potassium:sodium antiporter activity	IBA	molecular function
GO:0070588	calcium ion transmembrane transport	IBA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0008273	calcium, potassium:sodium antiporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0006816	calcium ion transport	IEA	biological process
GO:0015297	antiporter activity	IEA	molecular function
GO:0006814	sodium ion transport	IEA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0015293	symporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006811	ion transport	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0098656	anion transmembrane transport	IEA	biological process
GO:0098656	anion transmembrane transport	IEA	biological process
GO:0098656	anion transmembrane transport	IEA	biological process
GO:0098656	anion transmembrane transport	IEA	biological process
GO:0006874	cellular calcium ion homeostasis	IDA	biological process
GO:0035725	sodium ion transmembrane transport	IDA	biological process
GO:0071944	cell periphery	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0008273	calcium, potassium:sodium antiporter activity	IDA	molecular function
GO:0008273	calcium, potassium:sodium antiporter activity	ISS	molecular function
GO:0070588	calcium ion transmembrane transport	IDA	biological process
GO:0006874	cellular calcium ion homeostasis	ISS	biological process
GO:0071805	potassium ion transmembrane transport	IDA	biological process
GO:0071944	cell periphery	ISS	cellular component
GO:0071944	cell periphery	ISS	cellular component
GO:0044214	spanning component of plasma membrane	RCA	cellular component
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0010629	negative regulation of gene expression	ISS	biological process
GO:0010629	negative regulation of gene expression	ISS	biological process
GO:0010629	negative regulation of gene expression	ISS	biological process
GO:0010629	negative regulation of gene expression	ISS	biological process
GO:0010629	negative regulation of gene expression	ISS	biological process
GO:0010629	negative regulation of gene expression	ISS	biological process
GO:0010629	negative regulation of gene expression	ISS	biological process
GO:0030282	bone mineralization	ISS	biological process
GO:0005262	calcium channel activity	IBA	molecular function
GO:0006874	cellular calcium ion homeostasis	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0008273	calcium, potassium:sodium antiporter activity	IBA	molecular function
GO:0070588	calcium ion transmembrane transport	IBA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0008273	calcium, potassium:sodium antiporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0006816	calcium ion transport	IEA	biological process
GO:0015297	antiporter activity	IEA	molecular function
GO:0006814	sodium ion transport	IEA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0015293	symporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006811	ion transport	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0098656	anion transmembrane transport	IEA	biological process
GO:0098656	anion transmembrane transport	IEA	biological process
GO:0098656	anion transmembrane transport	IEA	biological process
GO:0098656	anion transmembrane transport	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq