About Us

Search Result


Gene id 57419
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol SLC24A3   Gene   UCSC   Ensembl
Aliases NCKX3
Gene name solute carrier family 24 member 3
Alternate names sodium/potassium/calcium exchanger 3, Na(+)/K(+)/Ca(2+)-exchange protein 3, sodium calcium exchanger, solute carrier family 24 (sodium/potassium/calcium exchanger), member 3,
Gene location 20p11.23 (19212641: 19722925)     Exons: 17     NC_000020.11
Gene summary(Entrez) Plasma membrane sodium/calcium exchangers are an important component of intracellular calcium homeostasis and electrical conduction. Potassium-dependent sodium/calcium exchangers such as SLC24A3 are believed to transport 1 intracellular calcium and 1 pota
OMIM 602872

Protein Summary

Protein general information Q9HC58  

Name: Sodium/potassium/calcium exchanger 3 (Na(+)/K(+)/Ca(2+) exchange protein 3) (Solute carrier family 24 member 3)

Length: 644  Mass: 71992

Tissue specificity: Abundant in the brain. Expressed at low levels in the aorta, uterus and intestine.

Sequence MRPSGDEDRARRRRRRRRRRDLLLSQLCFLASVALLLWSLSSLREQKELDLMDLVGEDRKWMMARKLMQVNDTLT
SEDAGLRNSKNCTEPALHEFPNDIFTNEDRRQGAVVLHVLCAIYMFYALAIVCDDFFVPSLEKICERLHLSEDVA
GATFMAAGSSAPELFTSVIGVFITKGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVALSSWCLLRDSIYYTLSVI
ALIVFIYDEKVSWWESLVLVLMYLIYIVIMKYNACIHQCFERRTKGAGNMVNGLANNAEIDDSSNCDATVVLLKK
ANFHRKASVIMVDELLSAYPHQLSFSEAGLRIMITSHFPPKTRLSMASRMLINERQRLINSRAYTNGESEVAIKI
PIKHTVENGTGPSSAPDRGVNGTRRDDVVAEAGNETENENEDNENDEEEEEDEDDDEGPYTPFDTPSGKLETVKW
AFTWPLSFVLYFTVPNCNKPRWEKWFMVTFASSTLWIAAFSYMMVWMVTIIGYTLGIPDVIMGITFLAAGTSVPD
CMASLIVARQGMGDMAVSNSIGSNVFDILIGLGLPWALQTLAVDYGSYIRLNSRGLIYSVGLLLASVFVTVFGVH
LNKWQLDKKLGCGCLLLYGVFLCFSIMTEFNVFTFVNLPMCGDH
Structural information
Interpro:  IPR004481  IPR004837  IPR030248  
STRING:   ENSP00000333519
Other Databases GeneCards:  SLC24A3  Malacards:  SLC24A3

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0006874 cellular calcium ion home
ostasis
IDA biological process
GO:0035725 sodium ion transmembrane
transport
IDA biological process
GO:0071944 cell periphery
IDA cellular component
GO:0005886 plasma membrane
IDA cellular component
GO:0008273 calcium, potassium:sodium
antiporter activity
IDA molecular function
GO:0008273 calcium, potassium:sodium
antiporter activity
ISS molecular function
GO:0070588 calcium ion transmembrane
transport
IDA biological process
GO:0006874 cellular calcium ion home
ostasis
ISS biological process
GO:0071805 potassium ion transmembra
ne transport
IDA biological process
GO:0071944 cell periphery
ISS cellular component
GO:0071944 cell periphery
ISS cellular component
GO:0044214 spanning component of pla
sma membrane
RCA cellular component
GO:0150104 transport across blood-br
ain barrier
NAS biological process
GO:0010628 positive regulation of ge
ne expression
ISS biological process
GO:0010628 positive regulation of ge
ne expression
ISS biological process
GO:0010628 positive regulation of ge
ne expression
ISS biological process
GO:0010629 negative regulation of ge
ne expression
ISS biological process
GO:0010629 negative regulation of ge
ne expression
ISS biological process
GO:0010629 negative regulation of ge
ne expression
ISS biological process
GO:0010629 negative regulation of ge
ne expression
ISS biological process
GO:0010629 negative regulation of ge
ne expression
ISS biological process
GO:0010629 negative regulation of ge
ne expression
ISS biological process
GO:0010629 negative regulation of ge
ne expression
ISS biological process
GO:0030282 bone mineralization
ISS biological process
GO:0005262 calcium channel activity
IBA molecular function
GO:0006874 cellular calcium ion home
ostasis
IBA biological process
GO:0005887 integral component of pla
sma membrane
IBA cellular component
GO:0008273 calcium, potassium:sodium
antiporter activity
IBA molecular function
GO:0070588 calcium ion transmembrane
transport
IBA biological process
GO:0005886 plasma membrane
IEA cellular component
GO:0006811 ion transport
IEA biological process
GO:0008273 calcium, potassium:sodium
antiporter activity
IEA molecular function
GO:0016021 integral component of mem
brane
IEA cellular component
GO:0055085 transmembrane transport
IEA biological process
GO:0006816 calcium ion transport
IEA biological process
GO:0015297 antiporter activity
IEA molecular function
GO:0006814 sodium ion transport
IEA biological process
GO:0006813 potassium ion transport
IEA biological process
GO:0015293 symporter activity
IEA molecular function
GO:0016021 integral component of mem
brane
IEA cellular component
GO:0006811 ion transport
IEA biological process
GO:0016020 membrane
IEA cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0006811 ion transport
TAS biological process
GO:0016020 membrane
IEA cellular component
GO:0098656 anion transmembrane trans
port
IEA biological process
GO:0098656 anion transmembrane trans
port
IEA biological process
GO:0098656 anion transmembrane trans
port
IEA biological process
GO:0098656 anion transmembrane trans
port
IEA biological process
GO:0006874 cellular calcium ion home
ostasis
IDA biological process
GO:0035725 sodium ion transmembrane
transport
IDA biological process
GO:0071944 cell periphery
IDA cellular component
GO:0005886 plasma membrane
IDA cellular component
GO:0008273 calcium, potassium:sodium
antiporter activity
IDA molecular function
GO:0008273 calcium, potassium:sodium
antiporter activity
ISS molecular function
GO:0070588 calcium ion transmembrane
transport
IDA biological process
GO:0006874 cellular calcium ion home
ostasis
ISS biological process
GO:0071805 potassium ion transmembra
ne transport
IDA biological process
GO:0071944 cell periphery
ISS cellular component
GO:0071944 cell periphery
ISS cellular component
GO:0044214 spanning component of pla
sma membrane
RCA cellular component
GO:0150104 transport across blood-br
ain barrier
NAS biological process
GO:0010628 positive regulation of ge
ne expression
ISS biological process
GO:0010628 positive regulation of ge
ne expression
ISS biological process
GO:0010628 positive regulation of ge
ne expression
ISS biological process
GO:0010629 negative regulation of ge
ne expression
ISS biological process
GO:0010629 negative regulation of ge
ne expression
ISS biological process
GO:0010629 negative regulation of ge
ne expression
ISS biological process
GO:0010629 negative regulation of ge
ne expression
ISS biological process
GO:0010629 negative regulation of ge
ne expression
ISS biological process
GO:0010629 negative regulation of ge
ne expression
ISS biological process
GO:0010629 negative regulation of ge
ne expression
ISS biological process
GO:0030282 bone mineralization
ISS biological process
GO:0005262 calcium channel activity
IBA molecular function
GO:0006874 cellular calcium ion home
ostasis
IBA biological process
GO:0005887 integral component of pla
sma membrane
IBA cellular component
GO:0008273 calcium, potassium:sodium
antiporter activity
IBA molecular function
GO:0070588 calcium ion transmembrane
transport
IBA biological process
GO:0005886 plasma membrane
IEA cellular component
GO:0006811 ion transport
IEA biological process
GO:0008273 calcium, potassium:sodium
antiporter activity
IEA molecular function
GO:0016021 integral component of mem
brane
IEA cellular component
GO:0055085 transmembrane transport
IEA biological process
GO:0006816 calcium ion transport
IEA biological process
GO:0015297 antiporter activity
IEA molecular function
GO:0006814 sodium ion transport
IEA biological process
GO:0006813 potassium ion transport
IEA biological process
GO:0015293 symporter activity
IEA molecular function
GO:0016021 integral component of mem
brane
IEA cellular component
GO:0006811 ion transport
IEA biological process
GO:0016020 membrane
IEA cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0006811 ion transport
TAS biological process
GO:0016020 membrane
IEA cellular component
GO:0098656 anion transmembrane trans
port
IEA biological process
GO:0098656 anion transmembrane trans
port
IEA biological process
GO:0098656 anion transmembrane trans
port
IEA biological process
GO:0098656 anion transmembrane trans
port
IEA biological process
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Cryptorchidism MIK: 28606200

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract