• Gene id: 57410

Gene Summary

• Gene Symbol: SCYL1   Gene   UCSC   Ensembl
• Aliases: GKLP, HT019, NKTL, NTKL, P105, SCAR21, TAPK, TEIF, TRAP
• Gene name: SCY1 like pseudokinase 1
• Alternate names: N-terminal kinase-like protein, SCY1-like protein 1, SCY1-like, kinase-like 1, coated vesicle-associated kinase of 90 kDa, likely ortholog of mouse N-terminal kinase-like protein, telomerase regulation-associated protein, telomerase transcriptional elements-int,
• Gene location: 11q13.1 (65525080: 65538709)     Exons: 17     NC_000011.10
• Gene summary(Entrez): This gene encodes a transcriptional regulator belonging to the SCY1-like family of kinase-like proteins. The protein has a divergent N-terminal kinase domain that is thought to be catalytically inactive, and can bind specific DNA sequences through its C-t
• OMIM: 607982

Protein Summary

• Protein general information: Q96KG9  
  • Name: N terminal kinase like protein (Coated vesicle associated kinase of 90 kDa) (SCY1 like protein 1) (Telomerase regulation associated protein) (Telomerase transcriptional element interacting factor) (Teratoma associated tyrosine kinase)
  • Length: 808  
  • Mass: 89631
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MWFFARDPVRDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFKTLRHPN
  ILAYIDGLETEKCLHVVTEAVTPLGIYLKARVEAGGLKELEISWGLHQIVKALSFLVNDCSLIHNNVCMAAVFVD
  RAGEWKLGGLDYMYSAQGNGGGPPRKGIPELEQYDPPELADSSGRVVREKWSADMWRLGCLIWEVFNGPLPRAAA
  LRNPGKIPKTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSNRFVETNLFLEEIQIKEPAEKQKFFQELSKS
  LDAFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKFLSAEEYQQKIIPVVVKMFSSTDRAMRIRLLQQMEQ
  FIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKSMLLLAPKLNEANLNVELMKHFARLQAKDEQGPIRCNTTV
  CLGKIGSYLSASTRHRVLTSAFSRATRDPFAPSRVAGVLGFAATHNLYSMNDCAQKILPVLCGLTVDPEKSVRDQ
  AFKAIRSFLSKLESVSEDPTQLEEVEKDVHAASSPGMGGAAASWAGWAVTGVSSLTSKLIRSHPTTAPTETNIPQ
  RPTPEGVPAPAPTPVPATPTTSGHWETQEEDKDTAEDSSTADRWDDEDWGSLEQEAESVLAQQDDWSTGGQVSRA
  SQVSNSDHKSSKSPESDWSSWEAEGSWEQGWQEPSSQEPPPDGTRLASEYNWGGPESSDKGDPFATLSARPSTQP
  RPDSWGEDNWEGLETDSRQVKAELARKKREERRREMEAKRAERKVAKGPMKLGARKLD

• Structural information:
  • Protein Domains: (14..31-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011989  IPR016024  IPR011009  IPR000719  
  • Prosite: PS50011
  • STRING: ENSP00000270176
• Other Databases: GeneCards:  SCYL1  Malacards:  SCYL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	ISS	cellular component
GO:0030126	COPI vesicle coat	IDA	cellular component
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0021522	spinal cord motor neuron differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0030126	COPI vesicle coat	IEA	cellular component
GO:0034613	cellular protein localization	IEA	biological process
GO:0048666	neuron development	IEA	biological process
GO:0045296	cadherin binding	HDA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IDA	biological process
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IDA	cellular component
GO:0005801	cis-Golgi network	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0004713	protein tyrosine kinase activity	NAS	molecular function

Diseases

Associated diseases	References
Autosomal recessive spinocerebellar ataxias	KEGG:H01891
Autosomal recessive spinocerebellar ataxias	KEGG:H01891
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq