• Gene id: 57409

Gene Summary

• Gene Symbol: MIF4GD   Gene   UCSC   Ensembl
• Aliases: AD023, MIFD, SLIP1
• Gene name: MIF4G domain containing
• Alternate names: MIF4G domain-containing protein, SLBP (stem loop binding protein)-interacting protein 1, SLBP-interacting protein 1,
• Gene location: 17q25.1 (75271291: 75266227)     Exons: 10     NC_000017.11
• Gene summary(Entrez): This gene encodes a protein which interacts with the N-terminus of the stem-loop binding protein (SLBP) and the 3' end of histone mRNA. This interaction facilitates the activation of histone mRNA translation. Alternative splicing results in multiple trans
• OMIM: 616567

Protein Summary

• Protein general information: A9UHW6  
  • Name: MIF4G domain containing protein (SLBP interacting protein 1) (hSLIP1)
  • Length: 222  
  • Mass: 25423
• Sequence:

  MGEPSREEYKIQSFDAETQQLLKTALKDPGAVDLEKVANVIVDHSLQDCVFSKEAGRMCYAIIQAESKQAGQSVF
  RRGLLNRLQQEYQAREQLRARSLQGWVCYVTFICNIFDYLRVNNMPMMALVNPVYDCLFRLAQPDSLSKEEEVDC
  LVLQLHRVGEQLEKMNGQRMDELFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD

• Structural information:
  • Protein Domains: (3..20-)
    (/note="MIF4G"-)
  • Interpro: IPR016024  IPR016021  IPR003890  
• Other Databases: GeneCards:  MIF4GD  Malacards:  MIF4GD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0006446	regulation of translational initiation	IBA	biological process
GO:0008494	translation activator activity	IBA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0006417	regulation of translation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0045727	positive regulation of translation	IEA	biological process
GO:0008022	protein C-terminus binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881