• Gene id: 57403

Gene Summary

• Gene Symbol: RAB22A   Gene   UCSC   Ensembl
• Gene name: RAB22A, member RAS oncogene family
• Alternate names: ras-related protein Rab-22A, GTP-binding protein RAB22A, rab-22,
• Gene location: 20q13.32 (43266927: 43232589)     Exons: 15     NC_000015.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosom
• OMIM: 612966

Protein Summary

• Protein general information: Q9UL26  
  • Name: Ras related protein Rab 22A (Rab 22)
  • Length: 194  
  • Mass: 21855
• Sequence:

  MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYY
  RGSAAAIIVYDITKEETFSTLKNWVKELRQHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSIHAIFVETSAK
  NAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRSCC

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR001806  
  • Prosite: PS51419
  • STRING: ENSP00000244040
• Other Databases: GeneCards:  RAB22A  Malacards:  RAB22A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003924	GTPase activity	IBA	molecular function
GO:0012505	endomembrane system	IBA	cellular component
GO:0032482	Rab protein signal transduction	IBA	biological process
GO:0005769	early endosome	IBA	cellular component
GO:0006886	intracellular protein transport	IBA	biological process
GO:0006897	endocytosis	IBA	biological process
GO:0019003	GDP binding	IDA	molecular function
GO:0045335	phagocytic vesicle	IDA	cellular component
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0015629	actin cytoskeleton	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0001726	ruffle	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0005770	late endosome	IEA	cellular component
GO:0030670	phagocytic vesicle membrane	IEA	cellular component
GO:0045335	phagocytic vesicle	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0006897	endocytosis	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0003924	GTPase activity	IMP	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0007032	endosome organization	IEP	biological process
GO:0003924	GTPase activity	TAS	molecular function
GO:0005525	GTP binding	IMP	molecular function
GO:0097494	regulation of vesicle size	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)