• Gene id: 5740

Gene Summary

• Gene Symbol: PTGIS   Gene   UCSC   Ensembl
• Aliases: CYP8, CYP8A1, PGIS, PTGI
• Gene name: prostaglandin I2 synthase
• Alternate names: prostacyclin synthase, cytochrome P450, family 8, subfamily A, polypeptide 1, prostaglandin I2 (prostacyclin) synthase,
• Gene location: 20q13.13 (49568136: 49503873)     Exons: 10     NC_000020.11
• Gene summary(Entrez): This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this prot
• OMIM: 601699

Protein Summary

• Protein general information: Q16647  
  • Name: Prostacyclin synthase (EC 5.3.99.4) (Prostaglandin I2 synthase)
  • Length: 500  
  • Mass: 57104
  • Tissue specificity: Widely expressed; particularly abundant in ovary, heart, skeletal muscle, lung and prostate.
• Sequence:

  MAWAALLGLLAALLLLLLLSRRRTRRPGEPPLDLGSIPWLGYALDFGKDAASFLTRMKEKHGDIFTILVGGRYVT
  VLLDPHSYDAVVWEPRTRLDFHAYAIFLMERIFDVQLPHYSPSDEKARMKLTLLHRELQALTEAMYTNLHAVLLG
  DATEAGSGWHEMGLLDFSYSFLLRAGYLTLYGIEALPRTHESQAQDRVHSADVFHTFRQLDRLLPKLARGSLSVG
  DKDHMCSVKSRLWKLLSPARLARRAHRSKWLESYLLHLEEMGVSEEMQARALVLQLWATQGNMGPAAFWLLLFLL
  KNPEALAAVRGELESILWQAEQPVSQTTTLPQKVLDSTPVLDSVLSESLRLTAAPFITREVVVDLAMPMADGREF
  NLRRGDRLLLFPFLSPQRDPEIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRSYAVNS
  IKQFVFLVLVHLDLELINADVEIPEFDLSRYGFGLMQPEHDVPVRYRIRP

• Structural information:
  • Interpro: IPR001128  IPR024204  IPR002403  IPR036396  IPR027286  
  • PDB: 2IAG 3B6H
  • PDBsum: 2IAG 3B6H
  • STRING: ENSP00000244043
• Other Databases: GeneCards:  PTGIS  Malacards:  PTGIS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008116	prostaglandin-I synthase activity	IBA	molecular function
GO:0001516	prostaglandin biosynthetic process	IBA	biological process
GO:0020037	heme binding	IDA	molecular function
GO:0020037	heme binding	IDA	molecular function
GO:0008116	prostaglandin-I synthase activity	IDA	molecular function
GO:0001516	prostaglandin biosynthetic process	IDA	biological process
GO:0006690	icosanoid metabolic process	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	ISS	cellular component
GO:0004497	monooxygenase activity	IEA	molecular function
GO:0005506	iron ion binding	IEA	molecular function
GO:0020037	heme binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0001516	prostaglandin biosynthetic process	IEA	biological process
GO:0008116	prostaglandin-I synthase activity	IEA	molecular function
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006633	fatty acid biosynthetic process	IEA	biological process
GO:0016829	lyase activity	IEA	molecular function
GO:0006693	prostaglandin metabolic process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0001516	prostaglandin biosynthetic process	IEA	biological process
GO:0016853	isomerase activity	IEA	molecular function
GO:0008116	prostaglandin-I synthase activity	IEA	molecular function
GO:0106256	hydroperoxy icosatetraenoate dehydratase activity	IEA	molecular function
GO:0006690	icosanoid metabolic process	TAS	biological process
GO:0034356	NAD biosynthesis via nicotinamide riboside salvage pathway	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0019371	cyclooxygenase pathway	TAS	biological process
GO:0007566	embryo implantation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0046697	decidualization	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0050728	negative regulation of inflammatory response	IDA	biological process
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0008116	prostaglandin-I synthase activity	IDA	molecular function
GO:0008116	prostaglandin-I synthase activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0001516	prostaglandin biosynthetic process	IDA	biological process
GO:0001516	prostaglandin biosynthetic process	IDA	biological process
GO:1900119	positive regulation of execution phase of apoptosis	IDA	biological process
GO:0097190	apoptotic signaling pathway	IDA	biological process
GO:0071456	cellular response to hypoxia	IDA	biological process
GO:0045019	negative regulation of nitric oxide biosynthetic process	IDA	biological process
GO:0005901	caveola	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0035360	positive regulation of peroxisome proliferator activated receptor signaling pathway	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	ISS	cellular component
GO:0071354	cellular response to interleukin-6	IEP	biological process
GO:0071347	cellular response to interleukin-1	IEP	biological process
GO:0045766	positive regulation of angiogenesis	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00590	Arachidonic acid metabolism

Diseases

Associated diseases	References
Hypertension	PMID:12372404
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq