• Gene id: 5738

Gene Summary

• Gene Symbol: PTGFRN   Gene   UCSC   Ensembl
• Aliases: CD315, CD9P-1, EWI-F, FPRP, SMAP-6
• Gene name: prostaglandin F2 receptor inhibitor
• Alternate names: prostaglandin F2 receptor negative regulator, CD9 partner 1, glu-Trp-Ile EWI motif-containing protein F, prostaglandin F2-alpha receptor regulatory protein, prostaglandin F2-alpha receptor-associated protein,
• Gene location: 1p13.1 (116909915: 116990357)     Exons: 10     NC_000001.11
• OMIM: 610290

Protein Summary

• Protein general information: Q9P2B2  
  • Name: Prostaglandin F2 receptor negative regulator (CD9 partner 1) (CD9P 1) (Glu Trp Ile EWI motif containing protein F) (EWI F) (Prostaglandin F2 alpha receptor regulatory protein) (Prostaglandin F2 alpha receptor associated protein) (CD antigen CD315)
  • Length: 879  
  • Mass: 98556
• Sequence:

  MGRLASRPLLLALLSLALCRGRVVRVPTATLVRVVGTELVIPCNVSDYDGPSEQNFDWSFSSLGSSFVELASTWE
  VGFPAQLYQERLQRGEILLRRTANDAVELHIKNVQPSDQGHYKCSTPSTDATVQGNYEDTVQVKVLADSLHVGPS
  ARPPPSLSLREGEPFELRCTAASASPLHTHLALLWEVHRGPARRSVLALTHEGRFHPGLGYEQRYHSGDVRLDTV
  GSDAYRLSVSRALSADQGSYRCIVSEWIAEQGNWQEIQEKAVEVATVVIQPSVLRAAVPKNVSVAEGKELDLTCN
  ITTDRADDVRPEVTWSFSRMPDSTLPGSRVLARLDRDSLVHSSPHVALSHVDARSYHLLVRDVSKENSGYYYCHV
  SLWAPGHNRSWHKVAEAVSSPAGVGVTWLEPDYQVYLNASKVPGFADDPTELACRVVDTKSGEANVRFTVSWYYR
  MNRRSDNVVTSELLAVMDGDWTLKYGERSKQRAQDGDFIFSKEHTDTFNFRIQRTTEEDRGNYYCVVSAWTKQRN
  NSWVKSKDVFSKPVNIFWALEDSVLVVKARQPKPFFAAGNTFEMTCKVSSKNIKSPRYSVLIMAEKPVGDLSSPN
  ETKYIISLDQDSVVKLENWTDASRVDGVVLEKVQEDEFRYRMYQTQVSDAGLYRCMVTAWSPVRGSLWREAATSL
  SNPIEIDFQTSGPIFNASVHSDTPSVIRGDLIKLFCIITVEGAALDPDDMAFDVSWFAVHSFGLDKAPVLLSSLD
  RKGIVTTSRRDWKSDLSLERVSVLEFLLQVHGSEDQDFGNYYCSVTPWVKSPTGSWQKEAEIHSKPVFITVKMDV
  LNAFKYPLLIGVGLSTVIGLLSCLIGYCSSHWCCKKEVQETRRERRRLMSMEMD

• Structural information:
  • Protein Domains: (26..12-)
    1 (/note="Ig-like-C2-type)
    (149..26-)
    2 (/note="Ig-like-C2-type)
    (276..39-)
    3 (/note="Ig-like-C2-type)
    (406..53-)
    4 (/note="Ig-like-C2-type)
    (544..66-)
    5 (/note="Ig-like-C2-type)
    (688..81-)
    (/note="Ig-lik-)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR013106  
  • Prosite: PS50835
  • STRING: ENSP00000376899
• Other Databases: GeneCards:  PTGFRN  Malacards:  PTGFRN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IBA	cellular component
GO:0014905	myoblast fusion involved in skeletal muscle regeneration	ISS	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0034389	lipid droplet organization	IEA	biological process
GO:0014905	myoblast fusion involved in skeletal muscle regeneration	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0009986	cell surface	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq