• Gene id: 5733

Gene Summary

• Gene Symbol: PTGER3   Gene   UCSC   Ensembl
• Aliases: EP3, EP3-I, EP3-II, EP3-III, EP3-IV, EP3-VI, EP3e, PGE2-R, lnc003875
• Gene name: prostaglandin E receptor 3
• Alternate names: prostaglandin E2 receptor EP3 subtype, PGE receptor, EP3 subtype, PGE2 receptor EP3 subtype, prostaglandin E receotor EP3 subtype 3 isoform, prostaglandin E receptor 3 (subtype EP3), prostaglandin receptor (PGE-2), prostanoid EP3 receptor,
• Gene location: 1p31.1 (71047815: 70852357)     Exons: 3     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor may have many biological functions, which involve digestion, nervous system,
• OMIM: 176806

Protein Summary

• Protein general information: P43115  
  • Name: Prostaglandin E2 receptor EP3 subtype (PGE receptor EP3 subtype) (PGE2 receptor EP3 subtype) (PGE2 R) (Prostanoid EP3 receptor)
  • Length: 390  
  • Mass: 43310
  • Tissue specificity: Detected in kidney (PubMed
• Sequence:

  MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLLTGFVGNALAMLLVSR
  SYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRWEHIDPSGRLCTFFGLTMTVFGLSSLFIASA
  MAVERALAIRAPHWYASHMKTRATRAVLLGVWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNW
  GNLFFASAFAFLGLLALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI
  MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQIRYHTNNYASSSTSLP
  CQCSSTLMWSDHLER

• Structural information:
  • Interpro: IPR001481  IPR000276  IPR017452  IPR008365  IPR001244   IPR000265  
  • Prosite: PS50262
  • PDB: 6AK3 6M9T
  • PDBsum: 6AK3 6M9T
  • STRING: ENSP00000349003
• Other Databases: GeneCards:  PTGER3  Malacards:  PTGER3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060455	negative regulation of gastric acid secretion	IBA	biological process
GO:0014827	intestine smooth muscle contraction	IBA	biological process
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004957	prostaglandin E receptor activity	IBA	molecular function
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0004957	prostaglandin E receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004955	prostaglandin receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004957	prostaglandin E receptor activity	TAS	molecular function
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0008219	cell death	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0031622	positive regulation of fever generation	ISS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004957	prostaglandin E receptor activity	NAS	molecular function
GO:0016021	integral component of membrane	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04080	Neuroactive ligand-receptor interaction
hsa04024	cAMP signaling pathway
hsa05163	Human cytomegalovirus infection
hsa04020	Calcium signaling pathway
hsa04923	Regulation of lipolysis in adipocytes

Diseases

Associated diseases	References
leiomyoma	PMID:17407572
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq