• Gene id: 57325

Gene Summary

• Gene Symbol: KAT14   Gene   UCSC   Ensembl
• Aliases: ATAC2, CRP2BP, CSRP2BP, PRO1194, dJ717M23.1
• Gene name: lysine acetyltransferase 14
• Alternate names: cysteine-rich protein 2-binding protein, ADA2A-containing complex subunit 2, ATAC component 2 homolog, CRP2 binding partner, CRP2 binding protein, CSRP2-binding protein,
• Gene location: 20p11.23 (18142223: 18188386)     Exons: 10     NC_000020.11
• Gene summary(Entrez): CSRP2 is a protein containing two LIM domains, which are double zinc finger motifs found in proteins of diverse function. CSRP2 and some related proteins are thought to act as protein adapters, bridging two or more proteins to form a larger protein comple
• OMIM: 604758

Protein Summary

• Protein general information: Q9H8E8  
  • Name: Cysteine rich protein 2 binding protein (CSRP2 binding protein) (ADA2A containing complex subunit 2) (ATAC2) (CRP2 binding partner) (CRP2BP) (Lysine acetyltransferase 14)
  • Length: 782  
  • Mass: 88844
  • Tissue specificity: Expressed in skeletal muscle, heart, lung, placenta, brain, liver, pancreas and kidney. High expression in skeletal muscle and heart. Lower expression in lung.
• Sequence:

  MDSSIHLSSLISRHDDEATRTSTSEGLEEGEVEGETLLIVESEDQASVDLSHDQSGDSLNSDEGDVSWMEEQLSY
  FCDKCQKWIPASQLREQLSYLKGDNFFRFTCSDCSADGKEQYERLKLTWQQVVMLAMYNLSLEGSGRQGYFRWKE
  DICAFIEKHWTFLLGNRKKTSTWWSTVAGCLSVGSPMYFRSGAQEFGEPGWWKLVHNKPPTMKPEGEKLSASTLK
  IKAASKPTLDPIITVEGLRKRASRNPVESAMELKEKRSRTQEAKDIRRAQKEAAGFLDRSTSSTPVKFISRGRRP
  DVILEKGEVIDFSSLSSSDRTPLTSPSPSPSLDFSAPGTPASHSATPSLLSEADLIPDVMPPQALFHDDDEMEGD
  GVIDPGMEYVPPPAGSVASGPVVGVRKKVRGPEQIKQEVESEEEKPDRMDIDSEDTDSNTSLQTRAREKRKPQLE
  KDTKPKEPRYTPVSIYEEKLLLKRLEACPGAVAMTPEARRLKRKLIVRQAKRDRGLPLFDLDQVVNAALLLVDGI
  YGAKEGGISRLPAGQATYRTTCQDFRILDRYQTSLPSRKGFRHQTTKFLYRLVGSEDMAVDQSIVSPYTSRILKP
  YIRRDYETKPPKLQLLSQIRSHLHRSDPHWTPEPDAPLDYCYVRPNHIPTINSMCQEFFWPGIDLSECLQYPDFS
  VVVLYKKVIIAFGFMVPDVKYNEAYISFLFVHPEWRRAGIATFMIYHLIQTCMGKDVTLHVSASNPAMLLYQKFG
  FKTEEYVLDFYDKYYPLESTECKHAFFLRLRR

• Structural information:
  • Protein Domains: (638..78-)
    (/note="N-acetyltransferase-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00532"-)
  • Interpro: IPR016181  IPR000182  IPR037829  
  • Prosite: PS51186
  • STRING: ENSP00000392318
• Other Databases: GeneCards:  KAT14  Malacards:  KAT14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005671	Ada2/Gcn5/Ada3 transcription activator complex	IBA	cellular component
GO:0004402	histone acetyltransferase activity	IBA	molecular function
GO:0016573	histone acetylation	IBA	biological process
GO:0005671	Ada2/Gcn5/Ada3 transcription activator complex	IEA	cellular component
GO:0008080	N-acetyltransferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004402	histone acetyltransferase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000086	G2/M transition of mitotic cell cycle	IEA	biological process
GO:0005671	Ada2/Gcn5/Ada3 transcription activator complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016573	histone acetylation	IEA	biological process
GO:0005671	Ada2/Gcn5/Ada3 transcription activator complex	IDA	cellular component
GO:0043966	histone H3 acetylation	IDA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IPI	cellular component
GO:0030274	LIM domain binding	NAS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881