• Gene id: 5732

Gene Summary

• Gene Symbol: PTGER2   Gene   UCSC   Ensembl
• Aliases: EP2
• Gene name: prostaglandin E receptor 2
• Alternate names: prostaglandin E2 receptor EP2 subtype, PGE receptor EP2 subtype, PGE2 receptor EP2 subtype, prostaglandin E receptor 2 (subtype EP2), 53kD, prostaglandin E receptor 2 (subtype EP2), 53kDa, prostanoid EP2 receptor,
• Gene location: 14q22.1 (52314311: 52328597)     Exons: 2     NC_000014.9
• Gene summary(Entrez): This gene encodes a receptor for prostaglandin E2, a metabolite of arachidonic acid which has different biologic activities in a wide range of tissues. Mutations in this gene are associated with aspirin-induced susceptibility to asthma. [provided by RefSe
• OMIM: 176804

Protein Summary

• Protein general information: P43116  
  • Name: Prostaglandin E2 receptor EP2 subtype (PGE receptor EP2 subtype) (PGE2 receptor EP2 subtype) (Prostanoid EP2 receptor)
  • Length: 358  
  • Mass: 39761
  • Tissue specificity: Placenta and lung.
• Sequence:

  MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGRRSSLSLFHVLVTELV
  FTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFSLATMLMLFAMALERYLSIGHPYFYQRRVSR
  SGGLAVLPVIYAVSLLFCSLPLLDYGQYVQYCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRM
  HRRSRRSRCGPSLGSGRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
  LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR008365  IPR001923  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000245457
• Other Databases: GeneCards:  PTGER2  Malacards:  PTGER2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004957	prostaglandin E receptor activity	IBA	molecular function
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0071380	cellular response to prostaglandin E stimulus	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0006954	inflammatory response	IBA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0004957	prostaglandin E receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004957	prostaglandin E receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0071380	cellular response to prostaglandin E stimulus	IEA	biological process
GO:0042127	regulation of cell population proliferation	IEA	biological process
GO:0032570	response to progesterone	IEA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:1904346	positive regulation of gastric mucosal blood circulation	IEA	biological process
GO:0004957	prostaglandin E receptor activity	IEA	molecular function
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS	biological process
GO:0071380	cellular response to prostaglandin E stimulus	ISS	biological process
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04080	Neuroactive ligand-receptor interaction
hsa04024	cAMP signaling pathway
hsa05163	Human cytomegalovirus infection
hsa04750	Inflammatory mediator regulation of TRP channels
hsa04924	Renin secretion

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)