• Gene id: 5731

Gene Summary

• Gene Symbol: PTGER1   Gene   UCSC   Ensembl
• Aliases: EP1
• Gene name: prostaglandin E receptor 1
• Alternate names: prostaglandin E2 receptor EP1 subtype, PGE receptor, EP1 subtype, PGE2 receptor EP1 subtype, prostaglandin E receptor 1 (subtype EP1), 42kD, prostaglandin E receptor 1 (subtype EP1), 42kDa, prostaglandin E receptor 1, subtype EP1, prostanoid EP1 receptor,
• Gene location: 19p13.12 (14475353: 14472465)     Exons: 3     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the G protein-coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). Through a phosphatidylinositol-calcium second messenger system, G-Q proteins mediate this
• OMIM: 176802

SNPs

rs17088625

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000008.11   g.22790337T>C
NC_000008.10   g.22647850T>C|SEQ=[T/C]|GENE=PEBP4

Protein Summary

• Protein general information: P34995  
  • Name: Prostaglandin E2 receptor EP1 subtype (PGE receptor EP1 subtype) (PGE2 receptor EP1 subtype) (Prostanoid EP1 receptor)
  • Length: 402  
  • Mass: 41801
  • Tissue specificity: Abundant in kidney. Lower level expression in lung, skeletal muscle and spleen, lowest expression in testis and not detected in liver brain and heart.
• Sequence:

  MSPCGPLNLSLAGEATTCAAPWVPNTSAVPPSGASPALPIFSMTLGAVSNLLALALLAQAAGRLRRRRSAATFLL
  FVASLLATDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMVFFGLCPLLLGCGMAVERCVGVTRPLLHAARVS
  VARARLALAAVAAVALAVALLPLARVGRYELQYPGTWCFIGLGPPGGWRQALLAGLFASLGLVALLAALVCNTLS
  GLALLRARWRRRSRRPPPASGPDSRRRWGAHGPRSASASSASSIASASTFFGGSRSSGSARRARAHDVEMVGQLV
  GIMVVSCICWSPMLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWVYILLRQAVLRQLLRLLPPRAGAKGG
  PAGLGLTPSAWEASSLRSSRHSGLSHF

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR008365  IPR001244  IPR000708  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000292513
• Other Databases: GeneCards:  PTGER1  Malacards:  PTGER1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004957	prostaglandin E receptor activity	IBA	molecular function
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0004957	prostaglandin E receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004955	prostaglandin receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004957	prostaglandin E receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0004957	prostaglandin E receptor activity	IEA	molecular function
GO:0120061	negative regulation of gastric emptying	IEA	biological process
GO:0007191	adenylate cyclase-activating dopamine receptor signaling pathway	IEA	biological process
GO:0031748	D1 dopamine receptor binding	IEA	molecular function
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04080	Neuroactive ligand-receptor interaction
hsa05163	Human cytomegalovirus infection
hsa04020	Calcium signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq