• Gene id: 5730

Gene Summary

• Gene Symbol: PTGDS   Gene   UCSC   Ensembl
• Aliases: L-PGDS, LPGDS, PDS, PGD2, PGDS, PGDS2
• Gene name: prostaglandin D2 synthase
• Alternate names: prostaglandin-H2 D-isomerase, PGD2 synthase, beta-trace protein, cerebrin-28, glutathione-independent PGD synthase, glutathione-independent PGD synthetase, lipocalin-type prostaglandin D synthase, prostaglandin D synthase, prostaglandin D2 synthase 21kDa ,
• Gene location: 9q34.3 (136977503: 136981741)     Exons: 7     NC_000009.12
• Gene summary(Entrez): The protein encoded by this gene is a glutathione-independent prostaglandin D synthase that catalyzes the conversion of prostaglandin H2 (PGH2) to postaglandin D2 (PGD2). PGD2 functions as a neuromodulator as well as a trophic factor in the central nervou
• OMIM: 176803

Protein Summary

• Protein general information: P41222  
  • Name: Prostaglandin H2 D isomerase (EC 5.3.99.2) (Beta trace protein) (Cerebrin 28) (Glutathione independent PGD synthase) (Lipocalin type prostaglandin D synthase) (Prostaglandin D2 synthase) (PGD2 synthase) (PGDS) (PGDS2)
  • Length: 190  
  • Mass: 21,029
• Sequence:

  MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLASNSSWLREKKAALSMCKSVVAPATDG
  GLNLTSTFLRKNQCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSVVETDYDQYALLYSQGSKGPGEDFRMATLYS
  RTQTPRAELKEKFTAFCKAQGFTEDTIVFLPQTDKCMTEQ

• Structural information:
  • Interpro: IPR012674  IPR002345  IPR022272  IPR000566  IPR002972  
  • Prosite: PS00213
  • PDB: 2WWP 3O19 3O22 3O2Y 4IMN 4IMO 4ORR 4ORS 4ORU 4ORW 4ORX 4ORY 4OS0 4OS3 4OS8 5WY9
  • PDBsum: 2WWP 3O19 3O22 3O2Y 4IMN 4IMO 4ORR 4ORS 4ORU 4ORW 4ORX 4ORY 4OS0 4OS3 4OS8 5WY9
  • STRING: ENSP00000360687
• Other Databases: GeneCards:  PTGDS  Malacards:  PTGDS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001516	prostaglandin biosynthetic process	ISS	biological process
GO:0001516	prostaglandin biosynthetic process	IDA	biological process
GO:0004667	prostaglandin-D synthase activity	ISS	molecular function
GO:0004667	prostaglandin-D synthase activity	IDA	molecular function
GO:0004667	prostaglandin-D synthase activity	TAS	molecular function
GO:0005215	transporter activity	ISS	molecular function
GO:0005501	retinoid binding	ISS	molecular function
GO:0005504	fatty acid binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005791	rough endoplasmic reticulum	IDA	cellular component
GO:0005794	Golgi apparatus	ISS	cellular component
GO:0006810	transport	ISS	biological process
GO:0019371	cyclooxygenase pathway	TAS	biological process
GO:0031965	nuclear membrane	IEA	cellular component
GO:0045187	regulation of circadian sleep/wake cycle, sleep	ISS	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:2000255	negative regulation of male germ cell proliferation	IEA	biological process
GO:0001516	prostaglandin biosynthetic process	IEA	biological process
GO:0001516	prostaglandin biosynthetic process	ISS	biological process
GO:0001516	prostaglandin biosynthetic process	IEA	biological process
GO:0001516	prostaglandin biosynthetic process	IDA	biological process
GO:0004667	prostaglandin-D synthase activity	IEA	molecular function
GO:0004667	prostaglandin-D synthase activity	IEA	molecular function
GO:0004667	prostaglandin-D synthase activity	ISS	molecular function
GO:0004667	prostaglandin-D synthase activity	TAS	molecular function
GO:0004667	prostaglandin-D synthase activity	IDA	molecular function
GO:0004667	prostaglandin-D synthase activity	TAS	molecular function
GO:0005215	transporter activity	IEA	molecular function
GO:0005215	transporter activity	IEA	molecular function
GO:0005215	transporter activity	ISS	molecular function
GO:0005501	retinoid binding	IEA	molecular function
GO:0005501	retinoid binding	ISS	molecular function
GO:0005504	fatty acid binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IDA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005791	rough endoplasmic reticulum	IEA	cellular component
GO:0005791	rough endoplasmic reticulum	IDA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005794	Golgi apparatus	ISS	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0006633	fatty acid biosynthetic process	IEA	biological process
GO:0006693	prostaglandin metabolic process	IEA	biological process
GO:0006810	transport	IEA	biological process
GO:0006810	transport	IEA	biological process
GO:0006810	transport	ISS	biological process
GO:0006810	transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016853	isomerase activity	IEA	molecular function
GO:0019371	cyclooxygenase pathway	TAS	biological process
GO:0031965	nuclear membrane	IEA	cellular component
GO:0036094	small molecule binding	IEA	molecular function
GO:0045187	regulation of circadian sleep/wake cycle, sleep	IEA	biological process
GO:0045187	regulation of circadian sleep/wake cycle, sleep	ISS	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:2000255	negative regulation of male germ cell proliferation	IEA	biological process
GO:0001516	prostaglandin biosynthetic process	ISS	biological process
GO:0001516	prostaglandin biosynthetic process	IDA	biological process
GO:0004667	prostaglandin-D synthase activity	ISS	molecular function
GO:0004667	prostaglandin-D synthase activity	TAS	molecular function
GO:0004667	prostaglandin-D synthase activity	IDA	molecular function
GO:0004667	prostaglandin-D synthase activity	TAS	molecular function
GO:0005215	transporter activity	ISS	molecular function
GO:0005501	retinoid binding	ISS	molecular function
GO:0005504	fatty acid binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005791	rough endoplasmic reticulum	IDA	cellular component
GO:0005794	Golgi apparatus	ISS	cellular component
GO:0006810	transport	ISS	biological process
GO:0019371	cyclooxygenase pathway	TAS	biological process
GO:0045187	regulation of circadian sleep/wake cycle, sleep	ISS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways

Diseases

Associated diseases	References
Cancer	GAD: 19124506
Cancer (breast)	GAD: 19276290
Carotid artery diseases	GAD: 15325247
Asthma	GAD: 19247692
Schizophrenia	GAD: 17230501
Kidney diseases	GAD: 19578796
Ovarian endometriosis	INFBASE: 15005245
Post-testicular obstruction	MIK: 10096390
Non obstructive azoospermia	MIK: 18206953
Oligozoospermia	MIK: 12090353
Azoospermia	MIK: 10096390
Complete androgen insensitivity syndrome (CAIS)	INFBASE: 19539906
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Nonobstructive azoospermia	MIK: 18206953
Oligozoospermia	MIK: 12090353
Post-testicular obstruction	MIK: 10096390
Obstructive azoospermia	MIK: 10096390
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
10096390	Post-testicular obstruction, obstructive and nonobstructive azoospermia				Male infertility
12090353	Oligozoospermia				Male infertility
15748601	non-obstructive azoospermia				Male infertility	PGDS
18206953	Nonobstructive azoospermia			53 (10 patients with normal semen parameters, 9 with obstructive azoospermia, 20 after vasectomy, 14 with nonobstructive azoospermia)	Male infertility	PGDS
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881