• Gene id: 57282

Gene Summary

• Gene Symbol: SLC4A10   Gene   UCSC   Ensembl
• Aliases: NBCn2, NCBE
• Gene name: solute carrier family 4 member 10
• Alternate names: sodium-driven chloride bicarbonate exchanger, solute carrier family 4, sodium bicarbonate cotransporter-like, member 10, solute carrier family 4, sodium bicarbonate transporter, member 10,
• Gene location: 2q24.2 (161620962: 161985275)     Exons: 35     NC_000002.12
• Gene summary(Entrez): This gene belongs to a small family of sodium-coupled bicarbonate transporters (NCBTs) that regulate the intracellular pH of neurons, the secretion of bicarbonate ions across the choroid plexus, and the pH of the brain extracellular fluid. The protein enc

Protein Summary

• Protein general information: Q6U841  
  • Name: Sodium driven chloride bicarbonate exchanger (Solute carrier family 4 member 10)
  • Length: 1118  
  • Mass: 125946
  • Tissue specificity: Predominantly expressed in the brain. {ECO
• Sequence:

  MEIKDQGAQMEPLLPTRNDEEAVVDRGGTRSILKTHFEKEDLEGHRTLFIGVHVPLGGRKSHRRHRHRGHKHRKR
  DRERDSGLEDGRESPSFDTPSQRVQFILGTEDDDEEHIPHDLFTELDEICWREGEDAEWRETARWLKFEEDVEDG
  GERWSKPYVATLSLHSLFELRSCILNGTVLLDMHANTLEEIADMVLDQQVSSGQLNEDVRHRVHEALMKQHHHQN
  QKKLTNRIPIVRSFADIGKKQSEPNSMDKNAGQVVSPQSAPACVENKNDVSRENSTVDFSKGLGGQQKGHTSPCG
  MKQRHEKGPPHQQEREVDLHFMKKIPPGAEASNILVGELEFLDRTVVAFVRLSPAVLLQGLAEVPIPTRFLFILL
  GPLGKGQQYHEIGRSIATLMTDEVFHDVAYKAKDRNDLVSGIDEFLDQVTVLPPGEWDPSIRIEPPKNVPSQEKR
  KIPAVPNGTAAHGEAEPHGGHSGPELQRTGRIFGGLILDIKRKAPYFWSDFRDAFSLQCLASFLFLYCACMSPVI
  TFGGLLGEATEGRISAIESLFGASMTGIAYSLFGGQPLTILGSTGPVLVFEKILFKFCKEYGLSYLSLRASIGLW
  TATLCIILVATDASSLVCYITRFTEEAFASLICIIFIYEALEKLFELSEAYPINMHNDLELLTQYSCNCVEPHNP
  SNGTLKEWRESNISASDIIWENLTVSECKSLHGEYVGRACGHDHPYVPDVLFWSVILFFSTVTLSATLKQFKTSR
  YFPTKVRSIVSDFAVFLTILCMVLIDYAIGIPSPKLQVPSVFKPTRDDRGWFVTPLGPNPWWTVIAAIIPALLCT
  ILIFMDQQITAVIINRKEHKLKKGCGYHLDLLMVAVMLGVCSIMGLPWFVAATVLSITHVNSLKLESECSAPGEQ
  PKFLGIREQRVTGLMIFILMGSSVFMTSILKFIPMPVLYGVFLYMGASSLKGIQFFDRIKLFWMPAKHQPDFIYL
  RHVPLRKVHLFTIIQMSCLGLLWIIKVSRAAIVFPMMVLALVFVRKLMDLLFTKRELSWLDDLMPESKKKKLEDA
  EKEEEQSMLAMEDEGTVQLPLEGHYRDDPSVINISDEMSKTALWRNLLITADNSKDKESSFPSKSSPS

• Structural information:
  • Interpro: IPR013769  IPR011531  IPR003020  IPR003024  IPR016152  
  • STRING: ENSP00000393066
• Other Databases: GeneCards:  SLC4A10  Malacards:  SLC4A10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008510	sodium:bicarbonate symporter activity	IBA	molecular function
GO:0051453	regulation of intracellular pH	IBA	biological process
GO:0015701	bicarbonate transport	IBA	biological process
GO:0005452	inorganic anion exchanger activity	IEA	molecular function
GO:0006820	anion transport	IEA	biological process
GO:0008509	anion transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0015297	antiporter activity	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0006814	sodium ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0015293	symporter activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0015701	bicarbonate transport	TAS	biological process
GO:0048172	regulation of short-term neuronal synaptic plasticity	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0043679	axon terminus	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0035264	multicellular organism growth	IEA	biological process
GO:0030641	regulation of cellular pH	IEA	biological process
GO:0021860	pyramidal neuron development	IEA	biological process
GO:0009416	response to light stimulus	IEA	biological process
GO:0006885	regulation of pH	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:1902600	proton transmembrane transport	IEA	biological process
GO:0097442	CA3 pyramidal cell dendrite	IEA	cellular component
GO:0097441	basal dendrite	IEA	cellular component
GO:0097440	apical dendrite	IEA	cellular component
GO:0048854	brain morphogenesis	IEA	biological process
GO:0036477	somatodendritic compartment	IEA	cellular component
GO:0035641	locomotory exploration behavior	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0015301	anion:anion antiporter activity	IEA	molecular function
GO:0009791	post-embryonic development	IEA	biological process
GO:0008510	sodium:bicarbonate symporter activity	IEA	molecular function
GO:0007601	visual perception	IEA	biological process
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0008510	sodium:bicarbonate symporter activity	IEA	molecular function
GO:0098794	postsynapse	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0098656	anion transmembrane transport	IEA	biological process
GO:0098656	anion transmembrane transport	IEA	biological process
GO:0035725	sodium ion transmembrane transport	IEA	biological process
GO:0035725	sodium ion transmembrane transport	IEA	biological process
GO:0035725	sodium ion transmembrane transport	IEA	biological process
GO:0035725	sodium ion transmembrane transport	IEA	biological process
GO:0035725	sodium ion transmembrane transport	IEA	biological process
GO:0008510	sodium:bicarbonate symporter activity	IDA	molecular function
GO:0048172	regulation of short-term neuronal synaptic plasticity	ISS	biological process
GO:0043679	axon terminus	ISS	cellular component
GO:0043025	neuronal cell body	ISS	cellular component
GO:0016323	basolateral plasma membrane	ISS	cellular component
GO:0030425	dendrite	ISS	cellular component
GO:0007601	visual perception	ISS	biological process
GO:0016324	apical plasma membrane	ISS	cellular component
GO:0045202	synapse	ISS	cellular component
GO:0016323	basolateral plasma membrane	ISS	cellular component
GO:0036477	somatodendritic compartment	ISS	cellular component
GO:0008510	sodium:bicarbonate symporter activity	ISS	molecular function
GO:0016021	integral component of membrane	NAS	cellular component
GO:0015701	bicarbonate transport	NAS	biological process
GO:0006821	chloride transport	NAS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq