• Gene id: 5726

Gene Summary

• Gene Symbol: TAS2R38   Gene   UCSC   Ensembl
• Aliases: PTC, T2R38, T2R61
• Gene name: taste 2 receptor member 38
• Alternate names: taste receptor type 2 member 38, PTC bitter taste receptor, taste receptor type 2 member 61, taste receptor, type 2, member 38,
• Gene location: 7q34 (141973772: 141972630)     Exons: 1     NC_000007.14
• Gene summary(Entrez): This gene encodes a seven-transmembrane G protein-coupled receptor that controls the ability to taste glucosinolates, a family of bitter-tasting compounds found in plants of the Brassica sp. Synthetic compounds phenylthiocarbamide (PTC) and 6-n-propylthio
• OMIM: 607751

SNPs

rs10246939

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000007.14   g.141972804T>C
NC_000007.13   g.141672604T>C
NG_016141.1   g.5970A>G
NM_176817.5   c.886A>G
NM_176817.4   c.886A>G
NW_003571040.1   g.114755T>C
NP_789787.5   p.Ile296Val|SEQ=[T/C]|GENE=TAS2R38

Protein Summary

• Protein general information: P59533  
  • Name: Taste receptor type 2 member 38 (T2R38) (PTC bitter taste receptor) (Taste receptor type 2 member 61) (T2R61)
  • Length: 333  
  • Mass: 37,892
• Sequence:

  MLTLTRIRTVSYEVRSTFLFISVLEFAVGFLTNAFVFLVNFWDVVKRQALSNSDCVLLCLSISRLFLHGLLFLSA
  IQLTHFQKLSEPLNHSYQAIIMLWMIANQANLWLAACLSLLYCSKLIRFSHTFLICLASWVSRKISQMLLGIILC
  SCICTVLCVWCFFSRPHFTVTTVLFMNNNTRLNWQIKDLNLFYSFLFCYLWSVPPFLLFLVSSGMLTVSLGRHMR
  TMKVYTRNSRDPSLEAHIKALKSLVSFFCFFVISSCAAFISVPLLILWRDKIGVMVCVGIMAACPSGHAAILISG
  NAKLRRAVMTILLWAQSSLKVRADHKADSRTLC

• Structural information:
  • Interpro: IPR007960  IPR030050  
  • CDD: cd15025
  • STRING: ENSP00000448219
• Other Databases: GeneCards:  TAS2R38  Malacards:  TAS2R38

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IBA	cellular component
GO:0016021	integral component of membrane	IC	cellular component
GO:0033038	bitter taste receptor activity	IDA	molecular function
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IEA	biological process
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IDA	biological process
GO:0004871	signal transducer activity	IEA	molecular function
GO:0004930	G-protein coupled receptor activity	IEA	molecular function
GO:0004930	G-protein coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IC	cellular component
GO:0033038	bitter taste receptor activity	IEA	molecular function
GO:0033038	bitter taste receptor activity	IDA	molecular function
GO:0050896	response to stimulus	IEA	biological process
GO:0050909	sensory perception of taste	IEA	biological process
GO:0050909	sensory perception of taste	IEA	biological process
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0016021	integral component of membrane	IBA	cellular component
GO:0016021	integral component of membrane	IC	cellular component
GO:0033038	bitter taste receptor activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04742	Taste transduction

Diseases

Associated diseases	References
Atherosclerosis	GAD: 15883422
Eating disorders	GAD: 19782709
Male factor infertility	MIK: 27172637
Male infertility	MIK: 27172637
Oligozoospermia or azoospermia	MIK: 20378615

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
27172637	Male infertility	T132903C in INSR, C109869T in SLC6A14, T824C in OR2W3, T886C in TAS2R38	Persian (Irani an)	196 (96 idiopathic infertile male patients, 100 normal fertile men (controls))	Male infertility	INSR SLC6A14 OR2W3 TAS2R38
20378615	Oligozoospermia or azoospermia	rs10246939	Europea n	442 (158 normospermic controls, 63 moderately oligozoospermic samples, 141 severe oligozoospermic samples and 80 non-obstructed azoospermic samples)	Male infertility	GWAS