• Gene id: 5724

Gene Summary

• Gene Symbol: PTAFR   Gene   UCSC   Ensembl
• Aliases: PAFR
• Gene name: platelet activating factor receptor
• Alternate names: platelet-activating factor receptor, PAF-R,
• Gene location: 1p35.3 (28193935: 28147165)     Exons: 4     NC_000001.11
• Gene summary(Entrez): This gene encodes a seven-transmembrane G-protein-coupled receptor for platelet-activating factor (PAF) that localizes to lipid rafts and/or caveolae in the cell membrane. PAF (1-0-alkyl-2-acetyl-sn-glycero-3-phosphorylcholine) is a phospholipid that play
• OMIM: 602354

Protein Summary

• Protein general information: P25105  
  • Name: Platelet activating factor receptor (PAF R) (PAFr)
  • Length: 342  
  • Mass: 39203
  • Tissue specificity: Expressed in the placenta, lung, left and right heart ventricles, heart atrium, leukocytes and differentiated HL-60 granulocytes. {ECO
• Sequence:

  MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLTMADMLFLITLPLWIV
  YYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVTRPIKTAQANTRKRGISLSLVIWVAIVGAAS
  YFLILDSTNTVPDSAGSGNVTRCFEHYEKGSVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAE
  VKRRALWMVCTVLAVFIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
  RKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR002282  
  • Prosite: PS00237 PS50262
  • PDB: 2B0X
  • PDBsum: 2B0X
  • STRING: ENSP00000362965
• Other Databases: GeneCards:  PTAFR  Malacards:  PTAFR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045028	G protein-coupled purinergic nucleotide receptor activity	IBA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004992	platelet activating factor receptor activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0004992	platelet activating factor receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006935	chemotaxis	TAS	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0006955	immune response	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0030667	secretory granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0070821	tertiary granule membrane	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1904317	cellular response to 2-O-acetyl-1-O-hexadecyl-sn-glycero-3-phosphocholine	IEA	biological process
GO:1904303	positive regulation of maternal process involved in parturition	IEA	biological process
GO:1904300	positive regulation of transcytosis	IEA	biological process
GO:1903238	positive regulation of leukocyte tethering or rolling	IEA	biological process
GO:0097755	positive regulation of blood vessel diameter	IEA	biological process
GO:0071548	response to dexamethasone	IEA	biological process
GO:0071398	cellular response to fatty acid	IEA	biological process
GO:0071320	cellular response to cAMP	IEA	biological process
GO:0071258	cellular response to gravity	IEA	biological process
GO:0060732	positive regulation of inositol phosphate biosynthetic process	IEA	biological process
GO:0051019	mitogen-activated protein kinase binding	IEA	molecular function
GO:0045987	positive regulation of smooth muscle contraction	IEA	biological process
GO:0045776	negative regulation of blood pressure	IEA	biological process
GO:0045727	positive regulation of translation	IEA	biological process
GO:0045056	transcytosis	IEA	biological process
GO:0043315	positive regulation of neutrophil degranulation	IEA	biological process
GO:0010863	positive regulation of phospholipase C activity	IEA	biological process
GO:0009609	response to symbiotic bacterium	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0032959	inositol trisphosphate biosynthetic process	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0001875	lipopolysaccharide immune receptor activity	IEA	molecular function
GO:0001816	cytokine production	IEA	biological process
GO:0001530	lipopolysaccharide binding	IEA	molecular function
GO:1904316	response to 2-O-acetyl-1-O-hexadecyl-sn-glycero-3-phosphocholine	IEA	biological process
GO:1904306	positive regulation of gastro-intestinal system smooth muscle contraction	IEA	biological process
GO:1904058	positive regulation of sensory perception of pain	IEA	biological process
GO:1903039	positive regulation of leukocyte cell-cell adhesion	IEA	biological process
GO:1902943	positive regulation of voltage-gated chloride channel activity	IEA	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IEA	biological process
GO:0046683	response to organophosphorus	IEA	biological process
GO:0045907	positive regulation of vasoconstriction	IEA	biological process
GO:0045410	positive regulation of interleukin-6 biosynthetic process	IEA	biological process
GO:0032760	positive regulation of tumor necrosis factor production	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007567	parturition	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004992	platelet activating factor receptor activity	IEA	molecular function
GO:0002693	positive regulation of cellular extravasation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0031663	lipopolysaccharide-mediated signaling pathway	IEA	biological process
GO:0035589	G protein-coupled purinergic nucleotide receptor signaling pathway	IEA	biological process
GO:0005543	phospholipid binding	IDA	molecular function
GO:0048015	phosphatidylinositol-mediated signaling	IDA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0005543	phospholipid binding	IDA	molecular function
GO:0004992	platelet activating factor receptor activity	IDA	molecular function
GO:0004992	platelet activating factor receptor activity	IDA	molecular function
GO:0004992	platelet activating factor receptor activity	IDA	molecular function
GO:0016021	integral component of membrane	NAS	cellular component
GO:0016021	integral component of membrane	NAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04020	Calcium signaling pathway
hsa05150	Staphylococcus aureus infection

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881